Comparing BWI76_RS05960 FitnessBrowser__Koxy:BWI76_RS05960 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
4zv2A An ancestral arginine-binding protein bound to glutamine (see paper)
37% identity, 82% coverage: 33:253/269 of query aligns to 4:224/225 of 4zv2A
4zv1A An ancestral arginine-binding protein bound to arginine (see paper)
37% identity, 82% coverage: 33:253/269 of query aligns to 4:226/226 of 4zv1A
5t0wA Crystal structure of the ancestral amino acid-binding protein anccdt- 1, a precursor of cyclohexadienyl dehydratase
34% identity, 84% coverage: 26:252/269 of query aligns to 3:228/229 of 5t0wA
5eyfB Crystal structure of solute-binding protein from enterococcus faecium with bound glutamate
36% identity, 79% coverage: 46:257/269 of query aligns to 26:239/243 of 5eyfB
2yjpA Crystal structure of the solute receptors for l-cysteine of neisseria gonorrhoeae (see paper)
35% identity, 83% coverage: 26:249/269 of query aligns to 4:228/247 of 2yjpA
1xt8B Crystal structure of cysteine-binding protein from campylobacter jejuni at 2.0 a resolution (see paper)
34% identity, 84% coverage: 24:249/269 of query aligns to 5:231/251 of 1xt8B
4ymxA Crystal structure of the substrate binding protein of an amino acid abc transporter (see paper)
36% identity, 82% coverage: 33:252/269 of query aligns to 1:222/224 of 4ymxA
6h20A Glnh bound to asn, mycobacterium tuberculosis (see paper)
32% identity, 91% coverage: 17:262/269 of query aligns to 34:284/287 of 6h20A
6h1uA Glnh bound to asp, mycobacterium tuberculosis (see paper)
32% identity, 91% coverage: 17:262/269 of query aligns to 34:284/287 of 6h1uA
6h2tA Glnh bound to glu, mycobacterium tuberculosis (see paper)
32% identity, 91% coverage: 17:262/269 of query aligns to 35:285/288 of 6h2tA
6svfA Crystal structure of the p235gk mutant of argbp from t. Maritima (see paper)
34% identity, 84% coverage: 28:252/269 of query aligns to 5:227/229 of 6svfA
3vvfA Crystal structure of ttc0807 complexed with arginine (see paper)
28% identity, 90% coverage: 18:258/269 of query aligns to 2:240/241 of 3vvfA
3vveA Crystal structure of ttc0807 complexed with lysine (see paper)
28% identity, 90% coverage: 18:258/269 of query aligns to 2:240/241 of 3vveA
3vvdA Crystal structure of ttc0807 complexed with ornithine (see paper)
28% identity, 90% coverage: 18:258/269 of query aligns to 2:240/241 of 3vvdA
3vv5A Crystal structure of ttc0807 complexed with (s)-2-aminoethyl-l- cysteine (aec) (see paper)
29% identity, 88% coverage: 22:258/269 of query aligns to 2:236/237 of 3vv5A
2ia4B Crystal structure of novel amino acid binding protein from shigella flexneri
31% identity, 91% coverage: 18:261/269 of query aligns to 1:251/278 of 2ia4B
8ovoA X-ray structure of the sf-iglusnfr-s72a in complex with l-aspartate
30% identity, 86% coverage: 21:252/269 of query aligns to 1:243/503 of 8ovoA
2vhaA Debp (see paper)
30% identity, 90% coverage: 19:261/269 of query aligns to 1:250/276 of 2vhaA
4h5fA Crystal structure of an amino acid abc transporter substrate-binding protein from streptococcus pneumoniae canada mdr_19a bound to l- arginine, form 1
38% identity, 59% coverage: 29:187/269 of query aligns to 7:170/240 of 4h5fA
4i62A 1.05 angstrom crystal structure of an amino acid abc transporter substrate-binding protein abpa from streptococcus pneumoniae canada mdr_19a bound to l-arginine
33% identity, 84% coverage: 29:255/269 of query aligns to 4:234/237 of 4i62A
>BWI76_RS05960 FitnessBrowser__Koxy:BWI76_RS05960
MRIAKTKIALALGMLVLAAQAQADQLADIKAAGVVKVATFDANPPFGSVDPKTHKIVGYD
VDFAEALAKSLGVKLELVATNPANRIPLLQSGKADLIVADITITPERAQVIDFSTPYFVT
GQQFLVPAKSPDKLDDYSKARIGAVKGTTGEQALHQRFPQSRVLSYDDIPLALTALRNGN
VQAITQDSTILAGLLAEAPDKANFKIIPDLLSKEEIGVGVKKGEPTLLKAVNDELVKLEK
SGEAAKIYDVWFGPSTKTPQPRAFTIEAK
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory