Comparing BWI76_RS05995 FitnessBrowser__Koxy:BWI76_RS05995 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
3td9A Crystal structure of a leucine binding protein livk (tm1135) from thermotoga maritima msb8 at 1.90 a resolution
39% identity, 93% coverage: 29:378/378 of query aligns to 2:347/350 of 3td9A
4gnrA 1.0 angstrom resolution crystal structure of the branched-chain amino acid transporter substrate binding protein livj from streptococcus pneumoniae str. Canada mdr_19a in complex with isoleucine
32% identity, 93% coverage: 29:378/378 of query aligns to 3:348/348 of 4gnrA
4n0qB Crystal structure of an abc transporter, substrate-binding protein from brucella melitensis 16m in complex with l-leucine using a crystal grown in a crystal former (microlytic)
28% identity, 87% coverage: 27:355/378 of query aligns to 1:326/345 of 4n0qB
1z18A Crystal structure analysis of periplasmic leu/ile/val-binding protein with bound valine (see paper)
27% identity, 79% coverage: 28:326/378 of query aligns to 2:297/344 of 1z18A
1z17A Crystal structure analysis of periplasmic leu/ile/val-binding protein with bound ligand isoleucine (see paper)
27% identity, 79% coverage: 28:326/378 of query aligns to 2:297/344 of 1z17A
1z16A Crystal structure analysis of periplasmic leu/ile/val-binding protein with bound leucine (see paper)
27% identity, 79% coverage: 28:326/378 of query aligns to 2:297/344 of 1z16A
1uskA L-leucine-binding protein with leucine bound (see paper)
27% identity, 75% coverage: 28:310/378 of query aligns to 2:283/345 of 1uskA
1usiA L-leucine-binding protein with phenylalanine bound (see paper)
27% identity, 75% coverage: 28:310/378 of query aligns to 2:283/345 of 1usiA
4zpjA Abc transporter substrate-binding protein from sphaerobacter thermophilus
26% identity, 72% coverage: 29:299/378 of query aligns to 3:278/371 of 4zpjA
4rdcA The crystal structure of a solute-binding protein (n280d mutant) from anabaena variabilis atcc 29413 in complex with proline
26% identity, 73% coverage: 64:340/378 of query aligns to 40:323/364 of 4rdcA
Sites not aligning to the query:
4qymA The crystal structure of a solute-binding protein (n280d mutant) from anabaena variabilis atcc 29413 in complex with methionine
26% identity, 73% coverage: 64:340/378 of query aligns to 40:323/364 of 4qymA
Sites not aligning to the query:
4otzA The crystal structure of a solute-binding protein (n280d mutant) from anabaena variabilis atcc 29413 in complex with cystein
26% identity, 73% coverage: 64:340/378 of query aligns to 40:323/364 of 4otzA
Sites not aligning to the query:
4og2A The crystal structure of a solute-binding protein (n280d mutant) from anabaena variabilis atcc 29413 in complex with leucine
26% identity, 73% coverage: 64:340/378 of query aligns to 40:323/364 of 4og2A
Sites not aligning to the query:
4oatA The crystal structure of a solute-binding protein (n280d mutant) from anabaena variabilis atcc 29413 in complex with isoleucine.
26% identity, 73% coverage: 64:340/378 of query aligns to 40:323/364 of 4oatA
Sites not aligning to the query:
4nv3A The crystal structure of a solute-binding protein (n280d mutant) from anabaena variabilis atcc 29413 in complex with valine.
26% identity, 73% coverage: 64:340/378 of query aligns to 40:323/364 of 4nv3A
Sites not aligning to the query:
4nqrA The crystal structure of a solute-binding protein (n280d mutant) from anabaena variabilis atcc 29413 in complex with alanine
26% identity, 73% coverage: 64:340/378 of query aligns to 40:323/364 of 4nqrA
Sites not aligning to the query:
4dqdA The crystal structure of a transporter in complex with 3-phenylpyruvic acid (see paper)
26% identity, 92% coverage: 27:373/378 of query aligns to 1:358/361 of 4dqdA
3sg0A The crystal structure of an extracellular ligand-binding receptor from rhodopseudomonas palustris haa2 (see paper)
26% identity, 92% coverage: 27:373/378 of query aligns to 2:359/361 of 3sg0A
4rv5A The crystal structure of a solute-binding protein from anabaena variabilis atcc 29413 in complex with pyruvic acid
26% identity, 73% coverage: 64:340/378 of query aligns to 40:323/364 of 4rv5A
Sites not aligning to the query:
4obbA The crystal structure of a solute-binding protein from anabaena variabilis atcc 29413 in complex with (3s)-3-methyl-2-oxopentanoic acid.
26% identity, 73% coverage: 64:340/378 of query aligns to 40:323/364 of 4obbA
Sites not aligning to the query:
>BWI76_RS05995 FitnessBrowser__Koxy:BWI76_RS05995
MNKFSGKASLMATLVAAWVGASSAQAAEIKIGVVLPLSGALSGYGQPSQKGLDIIQSITP
TLKNGDTVKLIVIDDKSDKVEAANAMQRLVSSDKVDAVIGEVTSSNTLAMTKIADDSKTP
LVSSTATNDRVTRNHPYVSRVCFSDSFQGVVGANLASRDLKAKTAAIVFDSSNDYSVGLA
KAFRTQFLKNGGTIPIEVQAPGGSKDFKAQLASVKAKNVDMIYMPIYYTEGALIAVQAKQ
LGLSKPVVGGDGLAADQVFFDVGKDAVNGYMTTDYYSPNAKEQTPAGEVFIKAWEAKYQQ
PTHTWGAMAADAYNVIINAMNQCSDPHDRVCVNEKIRATKDFQGVTGTLTLQNGDAIRSA
VINEVKDGKLAFRTVVNP
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory