Comparing BWI76_RS06050 FitnessBrowser__Koxy:BWI76_RS06050 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 4 hits to proteins with known functional sites (download)
P0AGC0 Hexose-6-phosphate:phosphate antiporter from Escherichia coli (strain K12) (see paper)
30% identity, 96% coverage: 16:431/433 of query aligns to 25:453/463 of P0AGC0
P0AA76 D-galactonate transporter; D-galactonate/H(+) symporter from Escherichia coli (strain K12) (see paper)
22% identity, 76% coverage: 17:345/433 of query aligns to 14:353/430 of P0AA76
Sites not aligning to the query:
6e9nA E. Coli d-galactonate:proton symporter in the inward open form (see paper)
21% identity, 76% coverage: 17:345/433 of query aligns to 3:334/409 of 6e9nA
Sites not aligning to the query:
6e9oA E. Coli d-galactonate:proton symporter mutant e133q in the outward substrate-bound form (see paper)
24% identity, 29% coverage: 17:141/433 of query aligns to 6:130/393 of 6e9oA
Sites not aligning to the query:
>BWI76_RS06050 FitnessBrowser__Koxy:BWI76_RS06050
MHARSATDINHHYRTLRPQLLMYMVIGYAAFYLTRKSVNYVLPALQTDLGLDKGDIGLLG
SLFYLTYGLSKFAAGLWHDSHGQRWFMGAGLFATGLLNVVFAFGESLTLLLAVWTLNGFF
QGWGWPPCARLLTHWYSRNERGFWWGCWNMSINIGGAIIPLISAFAAHWWGWQAAMLAPG
MISMASGIWLTLQLKGTPREEGLPSVGSWRNDPLELRQERQSPPMGLWQMLRTTMLKNPM
IWLLGVSYVLVYLIRIALNDWGNIWLTESHGVNLLSANATVMLFEAGGLLGALFAGWGSD
LLFSGQRAPMILLFTLGLMVSVAALWLAPVHHYALLAVCFFTVGFFVFGPQMLIGLAAVE
CGHKAAAGSISGFLGLFAYLGAALAGWPLSLVIERYGWSGMFSLLSVAAVLMGLLLMPLL
MASITTSAAQRIE
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory