SitesBLAST
Comparing BWI76_RS06070 FitnessBrowser__Koxy:BWI76_RS06070 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
P69874 Spermidine/putrescine import ATP-binding protein PotA; EC 7.6.2.11 from Escherichia coli (strain K12) (see 3 papers)
40% identity, 80% coverage: 1:205/255 of query aligns to 17:224/378 of P69874
- C26 (≠ D10) mutation to A: Lower ATPase activity and transport efficiency.
- F27 (≠ Y11) mutation to L: Lower ATPase activity and transport efficiency.
- F45 (≠ L29) mutation to L: Lower ATPase activity and transport efficiency.
- C54 (= C38) mutation to T: Loss of ATPase activity and transport.
- L60 (= L44) mutation to F: Lower ATPase activity and transport efficiency.
- L76 (= L60) mutation to P: Lower ATPase activity and transport efficiency.
- V135 (= V116) mutation to M: Loss of ATPase activity and transport.
- D172 (= D153) mutation to N: Loss of ATPase activity and transport.
Sites not aligning to the query:
- 276 C→A: Lower ATPase activity and transport efficiency.
- 297 mutation E->K,D: Lower ATPase activity and transport efficiency.; E→Q: Loss of ATPase activity and transport.
3puyA Crystal structure of an outward-facing mbp-maltose transporter complex bound to amp-pnp after crystal soaking of the pretranslocation state (see paper)
40% identity, 87% coverage: 2:224/255 of query aligns to 3:231/371 of 3puyA
- binding phosphoaminophosphonic acid-adenylate ester: W12 (≠ Y11), S37 (= S36), G38 (= G37), C39 (= C38), G40 (= G39), K41 (= K40), S42 (≠ T41), T43 (= T42), Q81 (= Q77), R128 (≠ A121), A132 (≠ Q128), S134 (= S130), G136 (= G132), Q137 (= Q133), E158 (= E154), H191 (= H187)
- binding magnesium ion: S42 (≠ T41), Q81 (= Q77)
3puxA Crystal structure of an outward-facing mbp-maltose transporter complex bound to adp-bef3 (see paper)
40% identity, 87% coverage: 2:224/255 of query aligns to 3:231/371 of 3puxA
- binding adenosine-5'-diphosphate: W12 (≠ Y11), G38 (= G37), C39 (= C38), G40 (= G39), K41 (= K40), S42 (≠ T41), T43 (= T42), R128 (≠ A121), S134 (= S130), Q137 (= Q133)
- binding beryllium trifluoride ion: S37 (= S36), G38 (= G37), K41 (= K40), Q81 (= Q77), S134 (= S130), G136 (= G132), H191 (= H187)
- binding magnesium ion: S42 (≠ T41), Q81 (= Q77)
3puwA Crystal structure of an outward-facing mbp-maltose transporter complex bound to adp-alf4 (see paper)
40% identity, 87% coverage: 2:224/255 of query aligns to 3:231/371 of 3puwA
- binding adenosine-5'-diphosphate: W12 (≠ Y11), V17 (≠ A16), G38 (= G37), C39 (= C38), G40 (= G39), K41 (= K40), S42 (≠ T41), T43 (= T42), R128 (≠ A121), A132 (≠ Q128), S134 (= S130), Q137 (= Q133)
- binding tetrafluoroaluminate ion: S37 (= S36), G38 (= G37), K41 (= K40), Q81 (= Q77), S134 (= S130), G135 (= G131), G136 (= G132), E158 (= E154), H191 (= H187)
- binding magnesium ion: S42 (≠ T41), Q81 (= Q77)
3puvA Crystal structure of an outward-facing mbp-maltose transporter complex bound to adp-vo4 (see paper)
40% identity, 87% coverage: 2:224/255 of query aligns to 3:231/371 of 3puvA
- binding adenosine-5'-diphosphate: W12 (≠ Y11), V17 (≠ A16), G38 (= G37), C39 (= C38), G40 (= G39), K41 (= K40), S42 (≠ T41), T43 (= T42), R128 (≠ A121), A132 (≠ Q128), S134 (= S130), Q137 (= Q133)
- binding magnesium ion: S42 (≠ T41), Q81 (= Q77)
P68187 Maltose/maltodextrin import ATP-binding protein MalK; EC 7.5.2.1 from Escherichia coli (strain K12) (see 5 papers)
40% identity, 87% coverage: 2:224/255 of query aligns to 4:232/371 of P68187
- A85 (≠ G80) mutation to M: Suppressor of EAA loop mutations in MalFG.
- K106 (≠ D101) mutation to C: Suppressor of EAA loop mutations in MalFG.
- V114 (≠ R106) mutation to C: Suppressor of EAA loop mutations in MalFG.
- V117 (≠ A109) mutation to M: Suppressor of EAA loop mutations in MalFG.
- E119 (≠ R111) mutation to K: Resistant to inhibitory effects of alpha-methylglucoside but retains transport capacity.
- A124 (≠ V116) mutation to T: Resistant to inhibitory effects of alpha-methylglucoside but retains transport capacity.
- G137 (= G132) mutation to A: Loss of maltose transport. Has greater ability to decrease mal gene expression than wild-type MalK.
- D158 (= D153) mutation to N: Loss of maltose transport but retains ability to repress mal genes.
- R228 (= R220) mutation to C: Resistant to inhibitory effects of alpha-methylglucoside but retains transport capacity.
Sites not aligning to the query:
- 241 F→I: Resistant to inhibitory effects of alpha-methylglucoside but retains transport capacity.
- 267 W→G: Normal maltose transport but constitutive mal gene expression.
- 278 G→P: Resistant to inhibitory effects of alpha-methylglucoside but retains transport capacity.
- 282 S→L: Resistant to inhibitory effects of alpha-methylglucoside but retains transport capacity.
- 284 G→S: Resistant to inhibitory effects of alpha-methylglucoside but retains transport capacity.
- 302 G→D: Resistant to inhibitory effects of alpha-methylglucoside but retains transport capacity.
- 308 E→Q: Maltose transport is affected but retains ability to interact with MalT.
- 322 S→F: Resistant to inhibitory effects of alpha-methylglucoside but retains transport capacity.
- 340 G→A: Maltose transport is affected but retains ability to interact with MalT.
- 346 G→S: Normal maltose transport but constitutive mal gene expression.
- 355 F→Y: Maltose transport is affected but retains ability to interact with MalT.
2awnB Crystal structure of the adp-mg-bound e. Coli malk (crystallized with atp-mg) (see paper)
40% identity, 87% coverage: 2:224/255 of query aligns to 3:231/374 of 2awnB
1q12A Crystal structure of the atp-bound e. Coli malk (see paper)
40% identity, 87% coverage: 2:224/255 of query aligns to 1:229/367 of 1q12A
- binding adenosine-5'-triphosphate: W10 (≠ Y11), S35 (= S36), G36 (= G37), C37 (= C38), G38 (= G39), K39 (= K40), S40 (≠ T41), T41 (= T42), R126 (≠ A121), A130 (≠ Q128), S132 (= S130), G134 (= G132), Q135 (= Q133)
P19566 Maltose/maltodextrin import ATP-binding protein MalK; EC 7.5.2.1 from Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) (see paper)
39% identity, 87% coverage: 2:224/255 of query aligns to 4:232/369 of P19566
- L86 (= L81) mutation to F: Loss of transport. No effect on ATP-binding activity but decrease in ATP hydrolysis. Retains repressor activity.
- P160 (= P155) mutation to L: Loss of transport. No effect on ATP-binding activity but decrease in ATP hydrolysis. Retains repressor activity.
- D165 (= D160) mutation to N: Loss of transport. No effect on ATP-binding activity but decrease in ATP hydrolysis. Retains repressor activity.
Sites not aligning to the query:
- 306 E→K: Loss of transport. No effect on ATP-binding and ATP hydrolysis. Retains repressor activity.
5xu1B Structure of a non-canonical abc transporter from streptococcus pneumoniae r6 (see paper)
42% identity, 73% coverage: 17:201/255 of query aligns to 23:215/226 of 5xu1B
P9WQI3 Trehalose import ATP-binding protein SugC; MtbSugC; Nucleotide-binding domain of SugABC transporter; NBD of SugABC transporter; SugABC transporter ATPase SugC; EC 7.5.2.- from Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) (see paper)
38% identity, 87% coverage: 4:224/255 of query aligns to 6:233/393 of P9WQI3
- H193 (= H187) mutation to A: Decreased hydrolysis of ATP. No change in KM, but 2-fold reduction in Vmax compared to wild-type.
7ahhC Opua inhibited inward-facing, sbd docked (see paper)
35% identity, 76% coverage: 12:205/255 of query aligns to 37:239/382 of 7ahhC
Sites not aligning to the query:
- binding (2R,3R,3aS,5R,7aR,9R,10R,10aS,12R,14aR)-2,9-bis(6-amino-9H-purin-9-yl)octahydro-2H,7H-difuro[3,2-d:3',2'-j][1,3,7,9,2,8]tetraoxadiphosphacyclododecine-3,5,10,12-tetrol 5,12-dioxide: 275, 297, 298
- binding phosphoaminophosphonic acid-adenylate ester: 12
7aheC Opua inhibited inward facing (see paper)
35% identity, 76% coverage: 12:205/255 of query aligns to 37:239/382 of 7aheC
Sites not aligning to the query:
- binding (2R,3R,3aS,5R,7aR,9R,10R,10aS,12R,14aR)-2,9-bis(6-amino-9H-purin-9-yl)octahydro-2H,7H-difuro[3,2-d:3',2'-j][1,3,7,9,2,8]tetraoxadiphosphacyclododecine-3,5,10,12-tetrol 5,12-dioxide: 275, 297, 298
7ahdC Opua (e190q) occluded (see paper)
34% identity, 76% coverage: 12:205/255 of query aligns to 37:239/260 of 7ahdC
- binding adenosine-5'-triphosphate: T39 (≠ K14), S61 (= S36), G62 (= G37), G64 (= G39), K65 (= K40), S66 (≠ T41), T67 (= T42), Q111 (= Q77), K161 (≠ W127), Q162 (= Q128), S164 (= S130), G166 (= G132), M167 (≠ Q133), Q188 (≠ E154), H221 (= H187)
Sites not aligning to the query:
3d31A Modbc from methanosarcina acetivorans (see paper)
38% identity, 80% coverage: 1:205/255 of query aligns to 1:204/348 of 3d31A
Sites not aligning to the query:
2d62A Crystal structure of multiple sugar binding transport atp- binding protein
37% identity, 76% coverage: 11:205/255 of query aligns to 16:219/375 of 2d62A
8hprD Lpqy-sugabc in state 4 (see paper)
37% identity, 75% coverage: 14:205/255 of query aligns to 16:210/362 of 8hprD
- binding adenosine-5'-triphosphate: S38 (= S36), C40 (= C38), G41 (= G39), K42 (= K40), S43 (≠ T41), T44 (= T42), Q82 (= Q77), R129 (= R124), Q133 (= Q128), S135 (= S130), G136 (= G131), G137 (= G132), Q159 (≠ E154), H192 (= H187)
- binding magnesium ion: S43 (≠ T41), Q82 (= Q77)
Sites not aligning to the query:
8hprC Lpqy-sugabc in state 4 (see paper)
37% identity, 75% coverage: 14:205/255 of query aligns to 16:210/363 of 8hprC
- binding adenosine-5'-triphosphate: S38 (= S36), G39 (= G37), G41 (= G39), K42 (= K40), S43 (≠ T41), Q82 (= Q77), Q133 (= Q128), G136 (= G131), G137 (= G132), Q138 (= Q133), H192 (= H187)
- binding magnesium ion: S43 (≠ T41), Q82 (= Q77)
Sites not aligning to the query:
8hplC Lpqy-sugabc in state 1 (see paper)
37% identity, 75% coverage: 14:205/255 of query aligns to 14:208/384 of 8hplC
Sites not aligning to the query:
3fvqB Crystal structure of the nucleotide binding domain fbpc complexed with atp (see paper)
38% identity, 88% coverage: 2:225/255 of query aligns to 4:240/350 of 3fvqB
- binding adenosine-5'-triphosphate: F13 (≠ Y11), Q14 (≠ G12), T16 (≠ K14), V18 (≠ A16), S38 (= S36), G39 (= G37), C40 (= C38), G41 (= G39), K42 (= K40), T43 (= T41), T44 (= T42), R133 (= R124), E137 (≠ Q128), S139 (= S130), G141 (= G132), Q142 (= Q133)
- binding calcium ion: T43 (= T41), Q86 (= Q77)
Query Sequence
>BWI76_RS06070 FitnessBrowser__Koxy:BWI76_RS06070
MLQISHLSADYGGKPALADINLTLDSGELLVVLGPSGCGKTTLLNLIAGFVPYQHGSITL
EGQRVEGPGADRGVVFQHEGLLPWRNVQDNVALGLQLAGVDKTQRRATAARMLKKVGLEG
AEKRFIWQLSGGQRQRVGIARALAANPQLLLLDEPFGALDAFTREQMQTLLLSLWHETGK
KVLLITHDIEEAVFMATELVLLSPGPGRVLERLPLDFGRRFVAGESCRSIKSDPRFIEQR
EYVLSRVFEQREAFS
Or try a new SitesBLAST search
SitesBLAST's Database
SitesBLAST's database includes
(1) SwissProt
entries with experimentally-supported functional features;
and (2) protein structures with bound ligands, from the
BioLip database.
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory