Comparing BWI76_RS06075 FitnessBrowser__Koxy:BWI76_RS06075 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 1 hits to proteins with known functional sites (download)
B5Z7I3 Ergothioneine transport permease/ergothioneine binding protein EgtU from Helicobacter pylori (strain G27) (see paper)
28% identity, 50% coverage: 71:207/275 of query aligns to 53:184/553 of B5Z7I3
Sites not aligning to the query:
>BWI76_RS06075 FitnessBrowser__Koxy:BWI76_RS06075
MSVVINDKPRQRGLKWRWPLSRQLSLSLATLAVLLAIWWAVAALQLISPLFLPPPGQVWQ
KLIAIAGPQGFMDATLWQHLAASLTRIVIALLAAVLLGVPVGIAMGLSPTVRGILDPLIE
LYRPVPPLAYLPLMVIWFGIGETSKILLIYLAIFAPVAMSALAGVKSAQQVRIRAAQALG
ASRAQVLWLVILPGALPEILTGLRIGLGVGWSTLVAAELIAATRGLGFMVQSAGEFLATD
VVLAGIAVIAIIAFLLELGLRALQRRLTPWHGEVQ
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory