SitesBLAST
Comparing BWI76_RS06140 FitnessBrowser__Koxy:BWI76_RS06140 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
5u9pB Crystal structure of a gluconate 5-dehydrogenase from burkholderia cenocepacia j2315 in complex with NADP and tartrate
59% identity, 98% coverage: 5:254/254 of query aligns to 12:261/261 of 5u9pB
- active site: G27 (= G20), S152 (= S145), Y165 (= Y158), K169 (= K162)
- binding nadp nicotinamide-adenine-dinucleotide phosphate: G23 (= G16), R26 (≠ Q19), G27 (= G20), I28 (= I21), R48 (= R41), D73 (= D66), V74 (= V67), N100 (= N93), A101 (= A94), I150 (= I143), Y165 (= Y158), K169 (= K162), P195 (= P188), F198 (= F191), T200 (= T193), L202 (≠ M195), N203 (≠ T196)
3o03A Quaternary complex structure of gluconate 5-dehydrogenase from streptococcus suis type 2 (see paper)
50% identity, 98% coverage: 5:254/254 of query aligns to 7:250/254 of 3o03A
- active site: G22 (= G20), S147 (= S145), V157 (≠ I155), Y160 (= Y158), K164 (= K162)
- binding calcium ion: S147 (= S145), M148 (= M146), P190 (= P188)
- binding D-gluconic acid: I99 (≠ Q97), R101 (= R99), S147 (= S145), M149 (≠ Q147), R154 (= R152), Y160 (= Y158)
- binding nadp nicotinamide-adenine-dinucleotide phosphate: G18 (= G16), Y21 (≠ Q19), G22 (= G20), I23 (= I21), D42 (= D40), I43 (≠ R41), L47 (≠ R45), D68 (= D66), V69 (= V67), N95 (= N93), A96 (= A94), G97 (= G95), I145 (= I143), Y160 (= Y158), K164 (= K162), P190 (= P188)
1vl8B Crystal structure of gluconate 5-dehydrogenase (tm0441) from thermotoga maritima at 2.07 a resolution
40% identity, 98% coverage: 4:252/254 of query aligns to 1:251/252 of 1vl8B
- active site: G17 (= G20), S143 (= S145), I154 (= I155), Y157 (= Y158), K161 (= K162)
- binding nadp nicotinamide-adenine-dinucleotide phosphate: G13 (= G16), R16 (≠ Q19), G17 (= G20), L18 (≠ I21), S37 (≠ D40), R38 (= R41), C63 (≠ F65), D64 (= D66), V65 (= V67), A91 (≠ N93), A92 (= A94), G93 (= G95), I94 (= I96), V114 (= V116), I141 (= I143), S143 (= S145), Y157 (= Y158), K161 (= K162), P187 (= P188), G188 (= G189), Y190 (≠ F191), T192 (= T193), M194 (= M195), T195 (= T196)
4za2D Crystal structure of pectobacterium carotovorum 2-keto-3-deoxy-d- gluconate dehydrogenase complexed with NAD+ (see paper)
42% identity, 98% coverage: 3:252/254 of query aligns to 4:246/247 of 4za2D
- binding nicotinamide-adenine-dinucleotide: G17 (= G16), D19 (≠ A18), L22 (≠ I21), I42 (≠ R41), D65 (= D66), M66 (≠ V67), N92 (= N93), A93 (= A94), G94 (= G95), L115 (≠ V116), I143 (= I143), S145 (= S145), Y158 (= Y158), K162 (= K162), G189 (= G189), M191 (≠ F191), T193 (= T193), N195 (= N201)
4hp8B Crystal structure of a putative 2-deoxy-d-gluconate 3-dehydrogenase from agrobacterium tumefaciens (target efi-506435) with bound NADP
39% identity, 99% coverage: 2:252/254 of query aligns to 1:245/246 of 4hp8B
- active site: G19 (= G20), S138 (= S145), V148 (≠ I155), Y151 (= Y158), K155 (= K162)
- binding nadp nicotinamide-adenine-dinucleotide phosphate: G15 (= G16), N17 (≠ A18), T18 (≠ Q19), G19 (= G20), L20 (≠ I21), R40 (= R41), R41 (≠ T42), D63 (= D66), F64 (≠ V67), N85 (= N93), G87 (= G95), I88 (= I96), I136 (= I143), Y151 (= Y158), K155 (= K162), P181 (= P188), G182 (= G189), I184 (≠ F191), T186 (= T193), N188 (≠ M195), T189 (= T196)
3op4A Crystal structure of putative 3-ketoacyl-(acyl-carrier-protein) reductase from vibrio cholerae o1 biovar eltor str. N16961 in complex with NADP+ (see paper)
40% identity, 97% coverage: 4:250/254 of query aligns to 3:244/247 of 3op4A
- binding nadp nicotinamide-adenine-dinucleotide phosphate: G15 (= G16), S17 (≠ A18), R18 (≠ Q19), I20 (= I21), T40 (= T42), N62 (≠ D66), V63 (= V67), N89 (= N93), A90 (= A94), I92 (= I96), V139 (≠ I143), S141 (= S145), Y154 (= Y158), K158 (= K162), P184 (= P188), G185 (= G189), I187 (≠ F191), T189 (= T193), M191 (= M195)
4jroC Crystal structure of 3-oxoacyl-[acyl-carrier protein]reductase (fabg) from listeria monocytogenes in complex with NADP+
38% identity, 96% coverage: 7:251/254 of query aligns to 3:246/247 of 4jroC
- active site: G16 (= G20), S142 (= S145), Q152 (≠ I155), Y155 (= Y158), K159 (= K162)
- binding nadp nicotinamide-adenine-dinucleotide phosphate: G12 (= G16), S14 (≠ A18), R15 (≠ Q19), G16 (= G20), I17 (= I21), N35 (= N39), Y36 (vs. gap), N37 (≠ D40), G38 (≠ R41), S39 (≠ T42), N63 (≠ D66), V64 (= V67), N90 (= N93), A91 (= A94), I93 (= I96), I113 (≠ V116), S142 (= S145), Y155 (= Y158), K159 (= K162), P185 (= P188), I188 (≠ F191), T190 (= T193)
4i08A Crystal structure of beta-ketoacyl-acyl carrier protein reductase (fabg) from vibrio cholerae in complex with NADPH (see paper)
39% identity, 97% coverage: 4:250/254 of query aligns to 3:240/243 of 4i08A
- active site: G19 (= G20), N113 (= N117), S141 (= S145), Q151 (≠ I155), Y154 (= Y158), K158 (= K162)
- binding nadph dihydro-nicotinamide-adenine-dinucleotide phosphate: G15 (= G16), S17 (≠ A18), R18 (≠ Q19), I20 (= I21), T40 (= T42), N62 (≠ D66), V63 (= V67), N89 (= N93), A90 (= A94), G140 (≠ C144), S141 (= S145), Y154 (= Y158), K158 (= K162), P184 (= P188), G185 (= G189), T189 (= T193)
3uf0A Crystal structure of a putative NAD(p) dependent gluconate 5- dehydrogenase from beutenbergia cavernae(efi target efi-502044) with bound NADP (low occupancy)
38% identity, 98% coverage: 5:253/254 of query aligns to 3:249/249 of 3uf0A
- active site: G18 (= G20), S141 (= S145), V151 (≠ I155), Y154 (= Y158), K158 (= K162)
- binding nadp nicotinamide-adenine-dinucleotide phosphate: G14 (= G16), S17 (≠ Q19), G18 (= G20), I19 (= I21), R39 (= R41), D63 (≠ Q56), L64 (≠ A64), N89 (= N93), G91 (= G95), I92 (= I96), I139 (= I143), A140 (≠ C144), S141 (= S145), Y154 (= Y158), K158 (= K162), P184 (= P188), G185 (= G189), V187 (≠ F191), T189 (= T193), N191 (≠ M195), T192 (= T196)
7tzpG Crystal structure of putataive short-chain dehydrogenase/reductase (fabg) from klebsiella pneumoniae subsp. Pneumoniae ntuh-k2044 in complex with nadh (see paper)
39% identity, 98% coverage: 3:251/254 of query aligns to 2:246/247 of 7tzpG
- binding 1,4-dihydronicotinamide adenine dinucleotide: G15 (= G16), R18 (≠ Q19), G19 (= G20), I20 (= I21), D39 (= D40), R40 (= R41), C63 (≠ F65), I65 (≠ V67), N91 (= N93), G93 (= G95), I94 (= I96), V114 (= V116), Y155 (= Y158), K159 (= K162), I188 (≠ F191), T190 (= T193), T193 (= T196)
P0AEK2 3-oxoacyl-[acyl-carrier-protein] reductase FabG; 3-ketoacyl-acyl carrier protein reductase; Beta-Ketoacyl-acyl carrier protein reductase; Beta-ketoacyl-ACP reductase; EC 1.1.1.100 from Escherichia coli (strain K12) (see 2 papers)
37% identity, 97% coverage: 5:250/254 of query aligns to 1:241/244 of P0AEK2
- GASR 12:15 (≠ GSAQ 16:19) binding
- T37 (≠ R41) binding
- NV 59:60 (≠ DV 66:67) binding
- N86 (= N93) binding
- Y151 (= Y158) mutation to F: Defect in the affinity for NADPH.
- YAAAK 151:155 (≠ YAASK 158:162) binding
- A154 (≠ S161) mutation to T: Decreases in the thermolability of the reductase; when associated with K-233.
- K155 (= K162) mutation to A: Defect in the affinity for NADPH.
- I184 (≠ F191) binding
- E233 (≠ H242) mutation to K: Decreases in the thermolability of the reductase; when associated with T-154.
1q7bA The structure of betaketoacyl-[acp] reductase from e. Coli in complex with NADP+ (see paper)
37% identity, 96% coverage: 6:250/254 of query aligns to 1:240/243 of 1q7bA
- active site: G15 (= G20), E101 (= E109), S137 (= S145), Q147 (≠ I155), Y150 (= Y158), K154 (= K162)
- binding calcium ion: E232 (≠ H242), T233 (≠ L243)
- binding nadp nicotinamide-adenine-dinucleotide phosphate: G11 (= G16), S13 (≠ A18), R14 (≠ Q19), T36 (≠ R41), N58 (≠ D66), V59 (= V67), N85 (= N93), A86 (= A94), G87 (= G95), I88 (= I96), S137 (= S145), Y150 (= Y158), K154 (= K162), P180 (= P188), G181 (= G189), I183 (≠ F191)
Q9KJF1 (2S)-[(R)-hydroxy(phenyl)methyl]succinyl-CoA dehydrogenase subunit BbsD; (S,R)-2-(alpha-hydroxybenzyl)succinyl-CoA dehydrogenase subunit BbsD; EC 1.1.1.429 from Thauera aromatica (see 2 papers)
37% identity, 94% coverage: 12:249/254 of query aligns to 8:242/248 of Q9KJF1
- S15 (≠ Q19) binding
- D36 (= D40) binding
- D62 (= D66) binding
- I63 (≠ V67) binding
- N89 (= N93) binding
- Y153 (= Y158) binding
- K157 (= K162) binding
Sites not aligning to the query:
- 1 modified: Initiator methionine, Removed
7pcsB Structure of the heterotetrameric sdr family member bbscd (see paper)
37% identity, 94% coverage: 12:249/254 of query aligns to 7:241/247 of 7pcsB
- binding nicotinamide-adenine-dinucleotide: G11 (= G16), M16 (≠ I21), D35 (= D40), I36 (≠ R41), I62 (≠ V67), N88 (= N93), G90 (= G95), I138 (= I143), S140 (= S145), Y152 (= Y158), K156 (= K162), I185 (≠ F191)
1q7cA The structure of betaketoacyl-[acp] reductase y151f mutant in complex with NADPH fragment (see paper)
36% identity, 96% coverage: 6:250/254 of query aligns to 1:240/243 of 1q7cA
- active site: G15 (= G20), S137 (= S145), Q147 (≠ I155), F150 (≠ Y158), K154 (= K162)
- binding nadph dihydro-nicotinamide-adenine-dinucleotide phosphate: G11 (= G16), S13 (≠ A18), R14 (≠ Q19), A35 (≠ D40), T36 (≠ R41), L57 (≠ F65), N58 (≠ D66), V59 (= V67), G87 (= G95), I88 (= I96)
P0A2C9 3-oxoacyl-[acyl-carrier-protein] reductase FabG; 3-ketoacyl-acyl carrier protein reductase; Beta-Ketoacyl-acyl carrier protein reductase; Beta-ketoacyl-ACP reductase; EC 1.1.1.100 from Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) (see paper)
36% identity, 95% coverage: 9:250/254 of query aligns to 5:241/244 of P0A2C9
- M125 (= M132) mutation to I: Loss of the temperature-sensitive phenotype; when associated with T-223.
- A223 (= A232) mutation to T: Loss of the temperature-sensitive phenotype; when associated with I-125.
- S224 (= S233) mutation to F: Distorts the local conformation and prevent stacking around Phe-221. The S224F mutation would additionally disrupt the hydrogen bond formed between Ser-224 and Glu-226.
6t77A Crystal structure of klebsiella pneumoniae fabg(NADPH-dependent) NADP- complex at 1.75 a resolution (see paper)
35% identity, 97% coverage: 5:250/254 of query aligns to 1:241/244 of 6t77A
- active site: G16 (= G20), S138 (= S145), Y151 (= Y158)
- binding nadp nicotinamide-adenine-dinucleotide phosphate: G12 (= G16), S14 (≠ A18), R15 (≠ Q19), T37 (≠ R41), L58 (≠ F65), N59 (≠ D66), V60 (= V67), A87 (= A94), G88 (= G95), I89 (= I96)
3osuA Crystal structure of the 3-oxoacyl-acyl carrier protein reductase, fabg, from staphylococcus aureus
36% identity, 95% coverage: 10:250/254 of query aligns to 5:244/246 of 3osuA
5ha5D Crystal structure of an NAD-bound oxidoreductase from brucella ovis
37% identity, 97% coverage: 7:253/254 of query aligns to 4:244/244 of 5ha5D
- active site: G17 (= G20), S142 (= S145), Y155 (= Y158), K159 (= K162)
- binding nicotinamide-adenine-dinucleotide: G13 (= G16), R16 (≠ Q19), G17 (= G20), L18 (≠ I21), D37 (= D40), I38 (≠ R41), L62 (≠ F65), D63 (= D66), V64 (= V67), N90 (= N93), A91 (= A94), S142 (= S145), Y155 (= Y158), K159 (= K162), G186 (= G189), M188 (≠ F191), S190 (≠ T193)
P73574 3-oxoacyl-[acyl-carrier-protein] reductase; 3-ketoacyl-acyl carrier protein reductase; EC 1.1.1.100 from Synechocystis sp. (strain PCC 6803 / Kazusa) (see paper)
36% identity, 96% coverage: 7:251/254 of query aligns to 4:245/247 of P73574
- A14 (≠ S17) mutation to G: 4.2-fold increase in activity on acetoacetyl-CoA.
- P151 (≠ K153) mutation to F: 2.7-fold increase in activity on acetoacetyl-CoA.; mutation to V: 5.7-fold increase in activity on acetoacetyl-CoA.
- K160 (= K162) mutation to A: Almost no activity on acetoacetyl-CoA.
- F188 (≠ Y190) mutation to Y: 3.3-fold increase in activity on acetoacetyl-CoA.
- N198 (= N201) mutation to R: 3.5-fold increase in activity on acetoacetyl-CoA.
Query Sequence
>BWI76_RS06140 FitnessBrowser__Koxy:BWI76_RS06140
MRNLFDLSGKRALITGSAQGIGHLLAGGLAEYGAEIIINDRTQERADQAAQALVAQGFRA
VGYAFDVTQAAQVEQTIARIEEEVGAIDILINNAGIQRRFPFTEFPEEEWDNVIEVNQKG
VFLVSQQVAKYMMGRRAGKIINICSMQSELGRKTITPYAASKGAVKMLTRGMCVELAEYN
IQVNGIAPGYFATEMTTALVNDEAFSAWLYQRTPAARWGKPEELIGAAVYLASSAANFVN
GHLLFVDGGMLAAV
Or try a new SitesBLAST search
SitesBLAST's Database
SitesBLAST's database includes
(1) SwissProt
entries with experimentally-supported functional features;
and (2) protein structures with bound ligands, from the
BioLip database.
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory