SitesBLAST
Comparing BWI76_RS06160 FitnessBrowser__Koxy:BWI76_RS06160 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
7tm9A Crystal structure of bacterial alkaline phosphatase from klebsiella pneumoniae
94% identity, 93% coverage: 36:476/476 of query aligns to 1:441/441 of 7tm9A
1y6vA Structure of e. Coli alkaline phosphatase in presence of cobalt at 1.60 a resolution (see paper)
89% identity, 94% coverage: 28:476/476 of query aligns to 1:449/449 of 1y6vA
- active site: D51 (= D78), S102 (= S129), D153 (= D180), T155 (= T182), R166 (= R193), E322 (= E349), D327 (= D354), K328 (= K355), H331 (= H358), D369 (= D396), H370 (= H397), H412 (= H439)
- binding cobalt (ii) ion: D51 (= D78), D51 (= D78), S102 (= S129), T155 (= T182), E322 (= E349), D327 (= D354), D327 (= D354), H331 (= H358), D369 (= D396), H370 (= H397), H412 (= H439)
- binding phosphate ion: D101 (= D128), S102 (= S129), R166 (= R193), D327 (= D354), H370 (= H397), H412 (= H439)
1ew9A Alkaline phosphatase (E.C. 3.1.3.1) complex with mercaptomethyl phosphonate (see paper)
89% identity, 94% coverage: 28:476/476 of query aligns to 1:449/449 of 1ew9A
- active site: D51 (= D78), S102 (= S129), D153 (= D180), T155 (= T182), R166 (= R193), E322 (= E349), D327 (= D354), K328 (= K355), H331 (= H358), D369 (= D396), H370 (= H397), H412 (= H439)
- binding magnesium ion: D51 (= D78), T155 (= T182), E322 (= E349)
- binding mercaptomethyl phosphonate: S102 (= S129), R166 (= R193), D327 (= D354), H331 (= H358), H412 (= H439)
- binding zinc ion: D51 (= D78), D51 (= D78), S102 (= S129), T155 (= T182), E322 (= E349), D327 (= D354), H331 (= H358), D369 (= D396), H370 (= H397), H412 (= H439)
1ew8A Alkaline phosphatase (E.C. 3.1.3.1) complex with phosphonoacetic acid (see paper)
89% identity, 94% coverage: 28:476/476 of query aligns to 1:449/449 of 1ew8A
- active site: D51 (= D78), S102 (= S129), D153 (= D180), T155 (= T182), R166 (= R193), E322 (= E349), D327 (= D354), K328 (= K355), H331 (= H358), D369 (= D396), H370 (= H397), H412 (= H439)
- binding magnesium ion: D51 (= D78), T155 (= T182), E322 (= E349)
- binding phosphonoacetic acid: D51 (= D78), D101 (= D128), S102 (= S129), R166 (= R193), D327 (= D354), H412 (= H439)
- binding phosphate ion: D51 (= D78), S102 (= S129), R166 (= R193), D327 (= D354), H412 (= H439)
- binding zinc ion: D51 (= D78), D51 (= D78), T155 (= T182), E322 (= E349), D327 (= D354), H331 (= H358), D369 (= D396), H370 (= H397), H412 (= H439)
1alhA Kinetics and crystal structure of a mutant e. Coli alkaline phosphatase (asp-369-->asn): a mechanism involving one zinc per active site (see paper)
89% identity, 93% coverage: 32:476/476 of query aligns to 2:446/446 of 1alhA
- active site: D48 (= D78), S99 (= S129), D150 (= D180), T152 (= T182), R163 (= R193), E319 (= E349), D324 (= D354), K325 (= K355), H328 (= H358), N366 (≠ D396), H367 (= H397), H409 (= H439)
- binding phosphate ion: S99 (= S129), R163 (= R193), H328 (= H358), H409 (= H439)
- binding zinc ion: D324 (= D354), H328 (= H358), H409 (= H439)
3dpcB Structure of e.Coli alkaline phosphatase mutant in complex with a phosphorylated peptide (see paper)
89% identity, 93% coverage: 32:476/476 of query aligns to 4:448/448 of 3dpcB
- active site: D50 (= D78), L101 (≠ S129), D152 (= D180), T154 (= T182), R165 (= R193), E321 (= E349), D326 (= D354), K327 (= K355), H330 (= H358), D368 (= D396), H369 (= H397), H411 (= H439)
- binding : L101 (≠ S129), Y115 (= Y143), N116 (= N144), G117 (= G145), R165 (= R193), K166 (= K194), S408 (= S436), H411 (= H439)
1ajbA Three-dimensional structure of the d153g mutant of e. Coli alkaline phosphatase: a mutant with weaker magnesium binding and increased catalytic activity (see paper)
89% identity, 94% coverage: 28:476/476 of query aligns to 1:449/449 of 1ajbA
- active site: D51 (= D78), S102 (= S129), G153 (≠ D180), T155 (= T182), R166 (= R193), E322 (= E349), D327 (= D354), K328 (= K355), H331 (= H358), D369 (= D396), H370 (= H397), H412 (= H439)
- binding magnesium ion: D51 (= D78), T155 (= T182), E322 (= E349)
- binding zinc ion: D51 (= D78), S102 (= S129), D327 (= D354), H331 (= H358), D369 (= D396), H370 (= H397), H412 (= H439)
1kh5A E. Coli alkaline phosphatase mutant (d330n) mimic of the transition states with aluminium fluoride (see paper)
89% identity, 93% coverage: 33:476/476 of query aligns to 1:444/444 of 1kh5A
- binding aluminum fluoride: S97 (= S129), R161 (= R193), D322 (= D354), H407 (= H439)
- binding magnesium ion: D46 (= D78), T150 (= T182), E317 (= E349)
- binding zinc ion: D46 (= D78), S97 (= S129), D322 (= D354), H326 (= H358), D364 (= D396), H365 (= H397), H407 (= H439)
5c66A E. Coli alkaline phosphatase in complex with tungstate (see paper)
90% identity, 93% coverage: 36:476/476 of query aligns to 1:441/441 of 5c66A
- active site: D43 (= D78), S94 (= S129), D145 (= D180), T147 (= T182), R158 (= R193), E314 (= E349), D319 (= D354), K320 (= K355), H323 (= H358), D361 (= D396), H362 (= H397), H404 (= H439)
- binding tungstate(vi)ion: D43 (= D78), D93 (= D128), S94 (= S129), R158 (= R193), D319 (= D354), H323 (= H358), H362 (= H397), H404 (= H439)
- binding zinc ion: D43 (= D78), D43 (= D78), S94 (= S129), T147 (= T182), E314 (= E349), D319 (= D354), H323 (= H358), D361 (= D396), H362 (= H397), H404 (= H439)
Q02QC9 Alkaline phosphatase H; High molecular weight phosphatase; H-AP; EC 3.1.3.1 from Pseudomonas aeruginosa (strain UCBPP-PA14) (see 2 papers)
72% identity, 98% coverage: 10:476/476 of query aligns to 8:475/476 of Q02QC9
- S128 (= S129) active site, Phosphoserine intermediate; modified: Phosphoserine
- S206 (= S207) modified: Phosphoserine
2w5vA Structure of tab5 alkaline phosphatase mutant his 135 asp with mg bound in the m3 site. (see paper)
28% identity, 85% coverage: 67:469/476 of query aligns to 3:338/346 of 2w5vA
- active site: D14 (= D78), S55 (= S129), D106 (= D180), T108 (= T182), R119 (≠ K212), E225 (= E349), D230 (= D354), W231 (≠ K355), H234 (= H358), D272 (= D396), H273 (= H397), H308 (= H439)
- binding magnesium ion: D14 (= D78), T108 (= T182), E225 (= E349), N237 (= N361), S239 (≠ C363)
- binding zinc ion: D14 (= D78), S55 (= S129), S55 (= S129), D230 (= D354), H234 (= H358), D272 (= D396), H273 (= H397), H308 (= H439)
3a52A Crystal structure of cold-active alkailne phosphatase from psychrophile shewanella sp. (see paper)
34% identity, 71% coverage: 72:411/476 of query aligns to 3:290/400 of 3a52A
- active site: D9 (= D78), S58 (= S129), H109 (≠ D180), T111 (= T182), R122 (= R193), E222 (= E349), D227 (= D354), W228 (≠ K355), H231 (= H358), D269 (= D396), H270 (= H397)
- binding magnesium ion: H109 (≠ D180), T111 (= T182), E222 (= E349), S276 (≠ I403), I277 (= I404)
- binding zinc ion: D227 (= D354), H231 (= H358)
Sites not aligning to the query:
2iucA Structure of alkaline phosphatase from the antarctic bacterium tab5 (see paper)
30% identity, 85% coverage: 67:469/476 of query aligns to 1:332/340 of 2iucA
- active site: D12 (= D78), S53 (= S129), H104 (≠ D180), T106 (= T182), R117 (≠ K212), E223 (= E349), D228 (= D354), W229 (≠ K355), H232 (= H358), D270 (= D396), H271 (= H397), H302 (= H439)
- binding magnesium ion: D12 (= D78), T106 (= T182), H113 (= H189), E122 (≠ S217), D126 (≠ Q221), E223 (= E349), N235 (= N361), S237 (≠ C363)
- binding phosphate ion: S53 (= S129), R117 (≠ K212), H302 (= H439)
- binding zinc ion: D12 (= D78), S53 (= S129), D228 (= D354), H232 (= H358), D270 (= D396), H271 (= H397), H302 (= H439)
P15693 Intestinal-type alkaline phosphatase 1; IAP-1; Intestinal alkaline phosphatase 1; Intestinal alkaline phosphatase I; IAP-I; EC 3.1.3.1 from Rattus norvegicus (Rat) (see 2 papers)
32% identity, 70% coverage: 65:399/476 of query aligns to 49:380/540 of P15693
- D62 (= D78) binding ; binding
- S112 (= S129) active site, Phosphoserine intermediate; binding
- C141 (vs. gap) modified: Disulfide link with 203
- S175 (≠ T182) binding
- C203 (≠ G214) modified: Disulfide link with 141
- N301 (≠ D320) modified: carbohydrate, N-linked (GlcNAc...) asparagine
- E331 (= E349) binding
- D336 (= D354) binding
- H340 (= H358) binding
- D377 (= D396) binding
- H378 (= H397) binding
Sites not aligning to the query:
- 1:20 signal peptide
- 428 modified: carbohydrate, N-linked (GlcNAc...) asparagine
- 452 binding
- 487 modified: Disulfide link with 494
- 494 modified: Disulfide link with 487
4kjgA Structure of rat intestinal alkaline phosphatase expressed in insect cell (see paper)
32% identity, 70% coverage: 65:399/476 of query aligns to 29:360/486 of 4kjgA
- active site: D42 (= D78), S92 (= S129), H153 (≠ D180), S155 (≠ T182), R166 (= R193), E311 (= E349), D316 (= D354), Q317 (≠ K355), H320 (= H358), D357 (= D396), H358 (= H397)
- binding 4-nitrophenyl phosphate: D91 (= D128), S92 (= S129), R166 (= R193)
- binding magnesium ion: D42 (= D78), S155 (≠ T182), E216 (= E246), F269 (= F286), E270 (≠ A287), D285 (vs. gap), E311 (= E349), S342 (≠ L380), T345 (≠ A383)
- binding zinc ion: D42 (= D78), S92 (= S129), D316 (= D354), H320 (= H358), D357 (= D396), H358 (= H397)
Sites not aligning to the query:
P05187 Alkaline phosphatase, placental type; Alkaline phosphatase Regan isozyme; Placental alkaline phosphatase 1; PLAP-1; EC 3.1.3.1 from Homo sapiens (Human) (see 11 papers)
28% identity, 86% coverage: 69:476/476 of query aligns to 55:491/535 of P05187
- D64 (= D78) binding ; binding
- I89 (vs. gap) to L: in dbSNP:rs13026692
- S114 (= S129) binding
- C143 (vs. gap) modified: Disulfide link with 205
- N144 (vs. gap) modified: carbohydrate, N-linked (GlcNAc...) asparagine
- S177 (≠ T182) binding
- C205 (≠ G214) modified: Disulfide link with 143
- R231 (≠ E240) to P: in dbSNP:rs1048988
- R263 (vs. gap) to H: in dbSNP:rs2853378
- N271 (≠ D266) modified: carbohydrate, N-linked (GlcNAc...) asparagine
- E333 (= E349) binding
- D338 (= D354) binding
- H342 (= H358) binding
- D379 (= D396) binding
- H380 (= H397) binding
- H454 (= H439) binding
- C489 (≠ N474) modified: Disulfide link with 496
Sites not aligning to the query:
- 1:22 signal peptide
- 25 P → L: in dbSNP:rs1130335
- 496 modified: Disulfide link with 489
- 506 modified: GPI-anchor amidated aspartate
2glqA X-ray structure of human alkaline phosphatase in complex with strontium (see paper)
28% identity, 86% coverage: 69:476/476 of query aligns to 33:469/479 of 2glqA
- active site: D42 (= D78), S92 (= S129), H153 (≠ D180), S155 (≠ T182), R166 (= R193), E311 (= E349), D316 (= D354), H317 (≠ K355), H320 (= H358), D357 (= D396), H358 (= H397), H432 (= H439)
- binding magnesium ion: D42 (= D78), S155 (≠ T182), E311 (= E349)
- binding strontium ion: E216 (vs. gap), F269 (= F286), E270 (≠ A287), D285 (vs. gap)
- binding zinc ion: D42 (= D78), S92 (= S129), S92 (= S129), D316 (= D354), H320 (= H358), D357 (= D396), H358 (= H397), H432 (= H439)
1ew2A Crystal structure of a human phosphatase (see paper)
28% identity, 86% coverage: 69:476/476 of query aligns to 33:469/479 of 1ew2A
- active site: D42 (= D78), S92 (= S129), H153 (≠ D180), S155 (≠ T182), R166 (= R193), E311 (= E349), D316 (= D354), H317 (≠ K355), H320 (= H358), D357 (= D396), H358 (= H397), H432 (= H439)
- binding magnesium ion: D42 (= D78), S155 (≠ T182), E216 (vs. gap), F269 (= F286), E270 (≠ A287), D285 (vs. gap), E311 (= E349)
- binding phosphate ion: D91 (= D128), S92 (= S129), R166 (= R193), D316 (= D354), H432 (= H439)
- binding zinc ion: D42 (= D78), D316 (= D354), H320 (= H358), D357 (= D396), H358 (= H397), H432 (= H439)
3mk0A Refinement of placental alkaline phosphatase complexed with nitrophenyl (see paper)
28% identity, 86% coverage: 69:476/476 of query aligns to 33:469/481 of 3mk0A
- active site: D42 (= D78), S92 (= S129), H153 (≠ D180), S155 (≠ T182), R166 (= R193), E311 (= E349), D316 (= D354), H317 (≠ K355), H320 (= H358), D357 (= D396), H358 (= H397), H432 (= H439)
- binding calcium ion: E216 (vs. gap), F269 (= F286), E270 (≠ A287), D285 (vs. gap)
- binding magnesium ion: D42 (= D78), S155 (≠ T182), E311 (= E349)
- binding p-nitrophenol: G211 (≠ A242), P213 (≠ A244), P218 (vs. gap), Y221 (vs. gap), R250 (≠ A267), L253 (= L270), M254 (≠ A271), S257 (= S274), E290 (≠ Q328), A294 (≠ K332), R297 (≠ D335)
- binding zinc ion: D42 (= D78), S92 (= S129), S92 (= S129), D316 (= D354), H320 (= H358), D357 (= D396), H358 (= H397), H432 (= H439)
1zefA Structure of alkaline phosphatase from human placenta in complex with its uncompetitive inhibitor l-phe (see paper)
28% identity, 86% coverage: 69:476/476 of query aligns to 33:469/481 of 1zefA
- active site: D42 (= D78), S92 (= S129), H153 (≠ D180), S155 (≠ T182), R166 (= R193), E311 (= E349), D316 (= D354), H317 (≠ K355), H320 (= H358), D357 (= D396), H358 (= H397), H432 (= H439)
- binding calcium ion: E216 (vs. gap), F269 (= F286), E270 (≠ A287), D285 (vs. gap)
- binding magnesium ion: D42 (= D78), S155 (≠ T182), E311 (= E349)
- binding phenylalanine: S92 (= S129), F107 (≠ N144), R166 (= R193), L253 (= L270), M254 (≠ A271), S257 (= S274), E290 (≠ Q328), E293 (= E331), A294 (≠ K332), R297 (≠ D335), D316 (= D354), H317 (≠ K355), H320 (= H358), H432 (= H439)
- binding zinc ion: D42 (= D78), S92 (= S129), S92 (= S129), D316 (= D354), H320 (= H358), D357 (= D396), H358 (= H397), H432 (= H439)
Query Sequence
>BWI76_RS06160 FitnessBrowser__Koxy:BWI76_RS06160
METIKVKLSALFIALIPLLGSPIIHAETTTAPVLENRAAQGDITTPGGARRLSGDQTEAL
RASLINKPAKNIILLIGDGMGDSEITAARNYAEGAGGFFKGIDALPLTGQYTHYSLDKKT
GKPDYVTDSAASATAWTTGVKSYNGALGVDIHEKDHQTILELAKAAGLATGNVSTAELQD
ATPAALVAHVTSRKCYGPSVTSEKCASNALEKGGKGSITEQLLNARPDVTLGGGAKTFAE
TATAGEWQGKTLHDQAVARGYQIVTDASSLAAISQANQDKPLLGLFAEGNMPVRWEGPKA
SYHGNIDKPAVTCTPNPKRDASVPTLAQMTEKAIDLLSSSEKGFFLQVEGASIDKQDHAA
NPCGQIGETVDLDEAVQKALEFAKKEGNTLVIVTADHAHASQIIPADTKAPGLTQALNTK
DGAVMVMSYGNSEETSMEHTGTQLRIAAYGPHAANVVGLTDQTDLFYTMKAALNLK
Or try a new SitesBLAST search
SitesBLAST's Database
SitesBLAST's database includes
(1) SwissProt
entries with experimentally-supported functional features;
and (2) protein structures with bound ligands, from the
BioLip database.
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory