SitesBLAST
Comparing BWI76_RS06460 FitnessBrowser__Koxy:BWI76_RS06460 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
4k28A 2.15 angstrom resolution crystal structure of a shikimate dehydrogenase family protein from pseudomonas putida kt2440 in complex with NAD+ (see paper)
48% identity, 97% coverage: 4:268/273 of query aligns to 2:266/266 of 4k28A
- binding manganese (ii) ion: C153 (≠ Y155), C164 (≠ H166), V176 (≠ L178), F180 (≠ P182)
- binding nicotinamide-adenine-dinucleotide: I129 (≠ S131), G130 (= G132), G132 (= G134), G133 (= G135), V134 (= V136), C153 (≠ Y155), D154 (= D156), P155 (= P157), R159 (≠ T161), S193 (= S195), P194 (= P196), V222 (= V224), G245 (= G247), M248 (= M250), A249 (= A251)
3tnlA 1.45 angstrom crystal structure of shikimate 5-dehydrogenase from listeria monocytogenes in complex with shikimate and NAD.
27% identity, 93% coverage: 2:254/273 of query aligns to 6:265/288 of 3tnlA
- binding nicotinamide-adenine-dinucleotide: M71 (≠ V68), G134 (= G132), A135 (≠ C133), G136 (= G134), G137 (= G135), A138 (≠ V136), N158 (≠ D156), R159 (≠ P157), D161 (vs. gap), F163 (vs. gap), T207 (≠ S195), V209 (≠ A197), M211 (= M199), F214 (= F202), V235 (= V224), Y237 (≠ T226), M261 (= M250), M262 (≠ A251)
- binding (3r,4s,5r)-3,4,5-trihydroxycyclohex-1-ene-1-carboxylic acid: S23 (≠ V19), S25 (= S21), N68 (≠ L65), S70 (≠ T67), K74 (= K71), N95 (= N92), D110 (= D108), Q265 (= Q254)
3tozA 2.2 angstrom crystal structure of shikimate 5-dehydrogenase from listeria monocytogenes in complex with NAD.
27% identity, 93% coverage: 2:254/273 of query aligns to 9:268/291 of 3tozA
- binding nicotinamide-adenine-dinucleotide: G137 (= G132), A138 (≠ C133), G139 (= G134), G140 (= G135), A141 (≠ V136), N161 (≠ D156), R162 (≠ P157), D164 (vs. gap), F166 (vs. gap), T210 (≠ S195), G211 (≠ P196), V212 (≠ A197), M214 (= M199), F217 (= F202), V238 (= V224), Y240 (≠ T226), G261 (= G247), M264 (= M250), M265 (≠ A251)
Q8Y9N5 Shikimate dehydrogenase (NADP(+)); SDH; EC 1.1.1.25 from Listeria monocytogenes serovar 1/2a (strain ATCC BAA-679 / EGD-e)
27% identity, 93% coverage: 2:254/273 of query aligns to 9:268/291 of Q8Y9N5
1nvtB Crystal structure of shikimate dehydrogenase (aroe or mj1084) in complex with NADP+ (see paper)
28% identity, 93% coverage: 1:254/273 of query aligns to 6:259/287 of 1nvtB
- active site: K75 (= K71), D111 (= D108)
- binding nadp nicotinamide-adenine-dinucleotide phosphate: I72 (≠ V68), G135 (= G132), G137 (= G134), G138 (= G135), A139 (≠ V136), N157 (vs. gap), R158 (vs. gap), T159 (≠ L154), K162 (≠ P157), A200 (≠ G194), T201 (≠ S195), P202 (= P196), I203 (≠ A197), M205 (= M199), L229 (≠ V224), Y231 (≠ T226), M255 (= M250), L256 (≠ A251)
- binding zinc ion: E22 (≠ T17), H23 (≠ Q18)
1nvtA Crystal structure of shikimate dehydrogenase (aroe or mj1084) in complex with NADP+ (see paper)
28% identity, 93% coverage: 1:254/273 of query aligns to 6:259/287 of 1nvtA
- active site: K75 (= K71), D111 (= D108)
- binding nadp nicotinamide-adenine-dinucleotide phosphate: G135 (= G132), A139 (≠ V136), N157 (vs. gap), R158 (vs. gap), T159 (≠ L154), K162 (≠ P157), A200 (≠ G194), T201 (≠ S195), P202 (= P196), I203 (≠ A197), M205 (= M199), L229 (≠ V224), Y231 (≠ T226), G252 (= G247), M255 (= M250), L256 (≠ A251)
Q58484 Shikimate dehydrogenase (NADP(+)); SDH; EC 1.1.1.25 from Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440) (Methanococcus jannaschii) (see paper)
28% identity, 93% coverage: 1:254/273 of query aligns to 1:254/282 of Q58484
1npdB X-ray structure of shikimate dehydrogenase complexed with NAD+ from e.Coli (ydib) northeast structural genomics research consortium (nesg) target er24 (see paper)
29% identity, 93% coverage: 2:254/273 of query aligns to 3:262/288 of 1npdB
- binding nicotinamide-adenine-dinucleotide: A132 (≠ C133), G133 (= G134), G134 (= G135), A135 (≠ V136), N155 (vs. gap), R156 (vs. gap), D158 (vs. gap), F160 (vs. gap), T204 (≠ S195), K205 (≠ P196), V206 (≠ A197), M208 (= M199), C232 (≠ V224), M258 (= M250), L259 (≠ A251)
P0A6D5 Quinate/shikimate dehydrogenase; NAD-dependent shikimate 5-dehydrogenase; EC 1.1.1.282 from Escherichia coli (strain K12) (see 4 papers)
29% identity, 93% coverage: 2:254/273 of query aligns to 3:262/288 of P0A6D5
- S22 (= S21) mutation to A: Kinetically unchanged as compared with the wild-type.
- Y39 (≠ M38) mutation to F: Kinetically unchanged as compared with the wild-type.
- S67 (≠ T67) mutation to A: Reduces activity towards quinate about 6-fold, but has a little effect on shikimate conversion.
- K71 (= K71) mutation to A: 3200-fold decrease in the affinity for quinate. 170-fold decrease in the affinity for shikimate.; mutation to G: 10-fold greater reduction in catalytic efficiency is observed with quinate than with shikimate.
- N92 (= N92) mutation to A: Alters protein structure. Loss of activity for both substrates.
- T106 (≠ L107) mutation to A: 2000-fold decrease in the affinity for quinate. 70-fold decrease in the affinity for shikimate. 10-fold greater reduction in catalytic efficiency is observed with quinate than with shikimate.
- D107 (= D108) mutation to A: Loss of activity towards quinate. 20000-fold decrease in the affinity for shikimate.
- AGGA 132:135 (≠ CGGV 133:136) binding
- NRRD 155:158 (vs. gap) binding
- K205 (≠ P196) binding
- CVYN 232:235 (≠ VVTA 224:227) binding
- G255 (= G247) binding
- Q262 (= Q254) mutation to A: 3-fold reduction in catalytic efficiency for both substrates.
Sites not aligning to the query:
- 1 modified: Initiator methionine, Removed
1o9bA Quinate/shikimate dehydrogenase ydib complexed with nadh (see paper)
29% identity, 91% coverage: 7:254/273 of query aligns to 2:256/280 of 1o9bA
- binding 1,4-dihydronicotinamide adenine dinucleotide: A126 (≠ C133), G127 (= G134), G128 (= G135), A129 (≠ V136), R150 (vs. gap), F154 (vs. gap), K199 (≠ P196), V200 (≠ A197), M202 (= M199), C226 (≠ V224), Y228 (≠ T226), M252 (= M250), L253 (≠ A251)
Q5HNV1 Shikimate dehydrogenase (NADP(+)); SDH; EC 1.1.1.25 from Staphylococcus epidermidis (strain ATCC 35984 / RP62A) (see paper)
25% identity, 90% coverage: 10:254/273 of query aligns to 4:239/269 of Q5HNV1
- SLS 13:15 (≠ VKS 19:21) binding
- T60 (= T67) binding
- N85 (= N92) binding
- D100 (= D108) binding
- Y211 (≠ T226) Plays a major role in the catalytic process and a minor role in the substrate binding; mutation to F: Leads to a 345-fold decrease in the catalytic efficiency and a 3-fold decrease in the affinity binding for shikimate.
- Q239 (= Q254) binding
2hk9B Crystal structure of shikimate dehydrogenase from aquifex aeolicus in complex with shikimate and NADP+ at 2.2 angstrom resolution (see paper)
24% identity, 93% coverage: 1:254/273 of query aligns to 1:242/267 of 2hk9B
- binding nadp nicotinamide-adenine-dinucleotide phosphate: V67 (= V68), G130 (= G132), G133 (= G135), A134 (≠ V136), N153 (≠ Y155), R154 (≠ D156), T155 (≠ P157), K158 (≠ A160), T188 (≠ S195), S189 (≠ P196), V190 (≠ A197), I214 (≠ V224), M238 (= M250), L239 (≠ A251)
- binding (3r,4s,5r)-3,4,5-trihydroxycyclohex-1-ene-1-carboxylic acid: S19 (≠ V19), S21 (= S21), N64 (≠ L65), T66 (= T67), K70 (= K71), N91 (= N92), D106 (= D108), Y216 (≠ T226), L239 (≠ A251), Q242 (= Q254)
2hk9A Crystal structure of shikimate dehydrogenase from aquifex aeolicus in complex with shikimate and NADP+ at 2.2 angstrom resolution (see paper)
24% identity, 93% coverage: 1:254/273 of query aligns to 1:242/269 of 2hk9A
- binding 2'-monophosphoadenosine-5'-diphosphate: V67 (= V68), G132 (= G134), G133 (= G135), A134 (≠ V136), N153 (≠ Y155), R154 (≠ D156), T155 (≠ P157), T188 (≠ S195), S189 (≠ P196), V190 (≠ A197)
- binding (3r,4s,5r)-3,4,5-trihydroxycyclohex-1-ene-1-carboxylic acid: S19 (≠ V19), S21 (= S21), N64 (≠ L65), K70 (= K71), N91 (= N92), D106 (= D108), Y216 (≠ T226), L239 (≠ A251), Q242 (= Q254)
O67049 Shikimate dehydrogenase (NADP(+)); SD; SDH; EC 1.1.1.25 from Aquifex aeolicus (strain VF5) (see paper)
24% identity, 93% coverage: 1:254/273 of query aligns to 1:242/269 of O67049
1nytA Shikimate dehydrogenase aroe complexed with NADP+ (see paper)
30% identity, 86% coverage: 7:241/273 of query aligns to 2:230/271 of 1nytA
- binding nadp nicotinamide-adenine-dinucleotide phosphate: K65 (= K71), D102 (= D108), G128 (= G134), G129 (= G135), A130 (≠ V136), N149 (= N158), R150 (≠ P159), T151 (≠ A160), R154 (≠ Q163), T188 (≠ S195), S189 (≠ P196), S190 (≠ A197), M213 (≠ V224)
Sites not aligning to the query:
P15770 Shikimate dehydrogenase (NADP(+)); SD; SDH; EC 1.1.1.25 from Escherichia coli (strain K12) (see paper)
30% identity, 86% coverage: 7:241/273 of query aligns to 2:230/272 of P15770
Sites not aligning to the query:
3dooA Crystal structure of shikimate dehydrogenase from staphylococcus epidermidis complexed with shikimate (see paper)
24% identity, 90% coverage: 10:254/273 of query aligns to 4:230/258 of 3dooA
- binding (3r,4s,5r)-3,4,5-trihydroxycyclohex-1-ene-1-carboxylic acid: S13 (≠ V19), S15 (= S21), N58 (≠ L65), T60 (= T67), K64 (= K71), N85 (= N92), D100 (= D108), F227 (≠ A251), Q230 (= Q254)
Q8ZPR4 Quinate/shikimate dehydrogenase; NAD-dependent shikimate 5-dehydrogenase; EC 1.1.1.282 from Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)
28% identity, 93% coverage: 2:254/273 of query aligns to 3:262/288 of Q8ZPR4
Q9KVT3 Shikimate dehydrogenase (NADP(+)); SDH; EC 1.1.1.25 from Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961)
29% identity, 86% coverage: 10:243/273 of query aligns to 9:236/278 of Q9KVT3
Sites not aligning to the query:
3pgjA 2.49 angstrom resolution crystal structure of shikimate 5- dehydrogenase (aroe) from vibrio cholerae o1 biovar eltor str. N16961 in complex with shikimate
29% identity, 86% coverage: 10:243/273 of query aligns to 5:232/272 of 3pgjA
- binding (3r,4s,5r)-3,4,5-trihydroxycyclohex-1-ene-1-carboxylic acid: S14 (≠ V19), S16 (= S21), N59 (≠ H59), T61 (= T67), K65 (= K71), N86 (= N92), D102 (= D108)
Sites not aligning to the query:
Query Sequence
>BWI76_RS06460 FitnessBrowser__Koxy:BWI76_RS06460
MVSGFTQVVAVIGHPITQVKSPENFNRYFADQQMDSVMIPVDIAPQAVADYLQALRGWHN
MSGVLVTVPHKQRAAALVDELTPRAQHLNAVNVIRKLADGRLQGDMLDGVGFQLAAEAHG
FNAAGKKALLSGCGGVGSAIAWGLCEAGLRQLALYDPNPATLQLLHNRLATHFPHVHLTD
LPATLNGLDVLVNGSPAGMAGFDPLPLPQTLLETLPVSAHVADVVTAPVITPLLAFARDR
GCAIQTGPEMALAQMKLMGQFIGAIAQEQGAAA
Or try a new SitesBLAST search
SitesBLAST's Database
SitesBLAST's database includes
(1) SwissProt
entries with experimentally-supported functional features;
and (2) protein structures with bound ligands, from the
BioLip database.
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory