Comparing BWI76_RS06695 FitnessBrowser__Koxy:BWI76_RS06695 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
2zyoA Crystal structure of cyclo/maltodextrin-binding protein complexed with maltotetraose (see paper)
38% identity, 92% coverage: 29:406/410 of query aligns to 8:384/385 of 2zyoA
5tu0A 1.9 angstrom resolution crystal structure of maltose-binding periplasmic protein male from listeria monocytogenes in complex with maltose
39% identity, 88% coverage: 41:402/410 of query aligns to 13:379/385 of 5tu0A
6dtuA Maltotetraose bound t. Maritima male1 (see paper)
33% identity, 92% coverage: 29:404/410 of query aligns to 4:375/375 of 6dtuA
6dtsA Maltotetraose bound t. Maritima male2 (see paper)
32% identity, 91% coverage: 29:403/410 of query aligns to 2:372/379 of 6dtsA
P59213 Maltooligosaccharide ABC transporter solute-binding lipoprotein; Maltodextrin-binding protein; Solute-binding protein MalX from Streptococcus pneumoniae serotype 4 (strain ATCC BAA-334 / TIGR4) (see paper)
32% identity, 97% coverage: 5:403/410 of query aligns to 16:418/423 of P59213
2xd3A The crystal structure of malx from streptococcus pneumoniae in complex with maltopentaose. (see paper)
33% identity, 90% coverage: 29:399/410 of query aligns to 1:372/375 of 2xd3A
4hw8A 2.25 angstrom structure of the extracellular solute-binding protein from staphylococcus aureus in complex with maltose.
32% identity, 92% coverage: 29:406/410 of query aligns to 6:375/376 of 4hw8A
5az7A Crystal structure of mbp-tom20 fusion protein with a 4-residue spacer in the connector helix (see paper)
30% identity, 91% coverage: 28:399/410 of query aligns to 5:369/434 of 5az7A
6k7fA Crystal structure of mbpholo-tim21 fusion protein with a 17-residue helical linker (see paper)
30% identity, 90% coverage: 28:398/410 of query aligns to 6:369/499 of 6k7fA
5azaA Crystal structure of mbp-saglb fusion protein with a 20-residue spacer in the connector helix (see paper)
30% identity, 90% coverage: 28:398/410 of query aligns to 5:368/836 of 5azaA
Sites not aligning to the query:
4b3nA Crystal structure of rhesus trim5alpha pry/spry domain (see paper)
30% identity, 91% coverage: 28:402/410 of query aligns to 1:368/557 of 4b3nA
5z0rB Structural insight into the zika virus capsid encapsulating the viral genome (see paper)
30% identity, 91% coverage: 28:401/410 of query aligns to 6:372/445 of 5z0rB
3csbA Crystal structure of monobody ysx1/maltose binding protein fusion complex (see paper)
30% identity, 90% coverage: 28:398/410 of query aligns to 2:365/464 of 3csbA
1llsA Crystal structure of unliganded maltose binding protein with xenon (see paper)
30% identity, 90% coverage: 28:398/410 of query aligns to 5:368/370 of 1llsA
1ez9B Structure of maltotetraitol bound to open-form maltodextrin binding protein in p1 crystal form (see paper)
30% identity, 90% coverage: 28:398/410 of query aligns to 5:368/370 of 1ez9B
3jyrA Crystal structures of the gach receptor of streptomyces glaucescens gla.O in the unliganded form and in complex with acarbose and an acarbose homolog. Comparison with acarbose-loaded maltose binding protein of salmonella typhimurium. (see paper)
30% identity, 90% coverage: 28:398/410 of query aligns to 5:368/370 of 3jyrA
3n94A Crystal structure of human pituitary adenylate cyclase 1 receptor- short n-terminal extracellular domain (see paper)
29% identity, 93% coverage: 28:410/410 of query aligns to 4:390/466 of 3n94A
3n96A Crystal structure of human crfr2 alpha extracellular domain in complex with urocortin 1
29% identity, 93% coverage: 28:408/410 of query aligns to 5:378/473 of 3n96A
Sites not aligning to the query:
6x91B Crystal structure of mbp-fused human apobec1 (see paper)
30% identity, 90% coverage: 28:395/410 of query aligns to 5:365/592 of 6x91B
Sites not aligning to the query:
6x91A Crystal structure of mbp-fused human apobec1 (see paper)
30% identity, 90% coverage: 28:395/410 of query aligns to 5:365/592 of 6x91A
>BWI76_RS06695 FitnessBrowser__Koxy:BWI76_RS06695
MKKNTLAALILTTLAAGQLVSLQAHAAGQLNVWEDIKKSDGIKAAVNDFEKQFNVKVNVQ
EMPYAQQLEKLRLDGPAGIGPDVLVIPNDQLGGAVVQGLLSPLTLDQAKQEAFTPASINA
FHMDNVLYGVPKAVETLVLIYNKDLIDKPLDSLQAWFDYSKKQREEGKYGLLAKFDQIYY
SWGAIGPMGGYIFGKNDKGGFNPQDVGLNKPGAVEAVTFLKKFYTDKVFPAGILGDNGLN
AIDSLFTEKKAAAVINGPWAFQPYEAAGIHYGVAPLPTLPDGKPMSSFLGVKGYVVSTWS
KDKALAQQFIEFINQPQYVKARYVATGEIPPLKAMIDDPLIKNDEKASAVAVQSARATAM
PGIPEMGEVWGPANAALELSLTGKQEPKAALDNAEKQIKMQIEAMQASNQ
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory