Comparing BWI76_RS06700 FitnessBrowser__Koxy:BWI76_RS06700 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 4 hits to proteins with known functional sites (download)
P02916 Maltose/maltodextrin transport system permease protein MalF from Escherichia coli (strain K12) (see 4 papers)
43% identity, 57% coverage: 180:427/435 of query aligns to 259:510/514 of P02916
4ki0F Crystal structure of the maltose-binding protein/maltose transporter complex in an outward-facing conformation bound to maltohexaose (see paper)
43% identity, 55% coverage: 180:420/435 of query aligns to 244:488/490 of 4ki0F
P94529 Arabinooligosaccharides transport system permease protein AraP from Bacillus subtilis (strain 168) (see paper)
25% identity, 68% coverage: 136:432/435 of query aligns to 32:312/313 of P94529
7cagA Mycobacterium smegmatis lpqy-sugabc complex in the catalytic intermediate state (see paper)
24% identity, 54% coverage: 139:372/435 of query aligns to 13:233/285 of 7cagA
>BWI76_RS06700 FitnessBrowser__Koxy:BWI76_RS06700
MIINPSENIAEARGAGRHAWCGLLLAIVPGFGQFYHRQWLKGIVFLVLLSSFMSIFYDFL
SEGLWGLYTLGEEVPRDNSIFLLAEGIISVLIIAFGVLVYFLSLRDAWVNGKKRDEGVAL
NSVRKQYQMLLSEGFPYLMITPGFILLVFVVIFPILFGFAIAFTNYNLYHTPPAKLVDWV
GFKNFINIFTLSIWRSTFFDVLQWTVVWTLLATTLQCTVGVLLAILVNQKDLRFKPMIRT
IFILPWAVPGFVTILVFAGMFNDSFGVINNAILSFFGISPKAWLTDPFWTKTALIMMQTW
LGFPFVFAMTTGVLQAIPDDLYEAATMDGASAFTRLRTITLPLVLYSIAPIIITQYTFNF
NNFNIIYLFNNGGPAVAGSNAGGTDILVSWIYKLTMSSSQYAIAATITILLSIFVVGLAL
WQFRATKSFKNDDMA
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory