Comparing BWI76_RS06705 BWI76_RS06705 binding-protein-dependent transport system inner membrane protein to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 4 hits to proteins with known functional sites (download)
P94530 Arabinooligosaccharides transport system permease protein AraQ from Bacillus subtilis (strain 168) (see paper)
34% identity, 95% coverage: 14:283/283 of query aligns to 12:281/281 of P94530
P68183 Maltose/maltodextrin transport system permease protein MalG from Escherichia coli (strain K12) (see 2 papers)
33% identity, 98% coverage: 8:283/283 of query aligns to 7:296/296 of P68183
4ki0F Crystal structure of the maltose-binding protein/maltose transporter complex in an outward-facing conformation bound to maltohexaose (see paper)
35% identity, 30% coverage: 155:239/283 of query aligns to 357:452/490 of 4ki0F
Sites not aligning to the query:
P02916 Maltose/maltodextrin transport system permease protein MalF from Escherichia coli (strain K12) (see 4 papers)
35% identity, 30% coverage: 155:239/283 of query aligns to 372:467/514 of P02916
Sites not aligning to the query:
>BWI76_RS06705 BWI76_RS06705 binding-protein-dependent transport system inner membrane protein
MAKSPSIKREKWIRLSLTWLVVIFVSTMIIYPLVWTVGASLNAGNSLLSTSIIPENLSFQ
HYADLFNGNVNYLTWYWNSMKISFMTMVLTLISVSFTAYAFSRFRFKGRQNGLMLFLLLQ
MIPQFSALIAIFVLSQLLGLINSHLALVLIYVGGMIPMNTWLMKGYLDAIPKDLDESARM
DGASSFRIFFEIIMPLSKPILAVVALFSFTGPLGDFILSSTILRTPDKYTLPIGLYNLVA
QKMGASYTTYAAGAVLIAVPVAILYLALQKYFVSGLTSGSTKG
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory