Comparing BWI76_RS06715 FitnessBrowser__Koxy:BWI76_RS06715 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 15 hits to proteins with known functional sites (download)
5e9aB Crystal structure analysis of the cold-adamped beta-galactosidase from rahnella sp. R3 (see paper)
70% identity, 99% coverage: 3:683/685 of query aligns to 2:682/684 of 5e9aB
5dfaA 3d structure of the e323a catalytic mutant of gan42b, a gh42 beta- galactosidase from g. Stearothermophilus (see paper)
49% identity, 99% coverage: 8:683/685 of query aligns to 8:683/685 of 5dfaA
3ttyA Crystal structure of beta-galactosidase from bacillus circulans sp. Alkalophilus in complex with galactose (see paper)
43% identity, 99% coverage: 7:683/685 of query aligns to 2:674/675 of 3ttyA
3ttsA Crystal structure of beta-galactosidase from bacillus circulans sp. Alkalophilus (see paper)
43% identity, 99% coverage: 7:683/685 of query aligns to 2:674/675 of 3ttsA
8ibtA Crystal structure of gh42 beta-galactosidase bibga42a from bifidobacterium longum subspecies infantis e318s mutant in complex with lacto-n-tetraose (see paper)
34% identity, 93% coverage: 6:644/685 of query aligns to 11:650/694 of 8ibtA
4ucfA Crystal structure of bifidobacterium bifidum beta-galactosidase in complex with alpha-galactose (see paper)
34% identity, 86% coverage: 6:596/685 of query aligns to 9:600/682 of 4ucfA
4uzsA Crystal structure of bifidobacterium bifidum beta-galactosidase (see paper)
34% identity, 86% coverage: 6:596/685 of query aligns to 10:601/687 of 4uzsA
Sites not aligning to the query:
8ibsA Crystal structure of gh42 beta-galactosidase bibga42a from bifidobacterium longum subspecies infantis e160a/e318a mutant in complex with galactose (see paper)
34% identity, 93% coverage: 6:644/685 of query aligns to 11:650/691 of 8ibsA
4uniA Beta-(1,6)-galactosidase from bifidobacterium animalis subsp. Lactis bl-04 in complex with galactose (see paper)
32% identity, 96% coverage: 6:662/685 of query aligns to 9:665/689 of 4uniA
4uozA Beta-(1,6)-galactosidase from bifidobacterium animalis subsp. Lactis bl-04 nucleophile mutant e324a in complex with galactose (see paper)
32% identity, 96% coverage: 6:662/685 of query aligns to 8:664/688 of 4uozA
O69315 Beta-galactosidase; Beta-gal; Lactase; EC 3.2.1.23 from Thermus thermophilus (see paper)
32% identity, 96% coverage: 17:677/685 of query aligns to 3:643/645 of O69315
1kwkA Crystal structure of thermus thermophilus a4 beta-galactosidase in complex with galactose (see paper)
32% identity, 96% coverage: 17:677/685 of query aligns to 3:643/644 of 1kwkA
1kwgA Crystal structure of thermus thermophilus a4 beta-galactosidase (see paper)
32% identity, 96% coverage: 17:677/685 of query aligns to 3:643/644 of 1kwgA
6lvwA Polyextremophilic beta-galactosidase from the antarctic haloarchaeon halorubrum lacusprofundi (see paper)
31% identity, 84% coverage: 17:589/685 of query aligns to 4:575/668 of 6lvwA
O31529 Beta-galactosidase YesZ; Beta-gal; Probable rhamnogalacturonan beta-galactosidase; EC 3.2.1.23 from Bacillus subtilis (strain 168) (see paper)
26% identity, 95% coverage: 11:663/685 of query aligns to 1:638/663 of O31529
>BWI76_RS06715 FitnessBrowser__Koxy:BWI76_RS06715
MKKFAPLSPKVNALLHGADYNPEQWENYPDIIDKDIAMMQQAKCNVMSVGIFSWAKLEPQ
EGVFEFGWLDSILDKLYAAGIHVFLATPSGARPAWMSQKYPQVLRVGRDRVPALHGGRHN
HCMSSPVYREKTLKINTLLAERYAQHPAVLGWHISNEYGGECHCSLCQERFRDWLKARYE
TLDNLNHAWWSTFWSHTYSDWSQIESPAPQGEVSIHGLNLDWHRFNTAQVTDFCRHEIAP
LKAANAELPVTTNFMEYFYDYDYWQLAPALDFISWDSYPMWHRDKDETTLACYTAMYHDM
MRSLKGGKPFVLMESTPSATNWQPTSKLKKPGMHILSSLQAVAHGADSVQYFQWRKSRGS
VEKFHGAIIDHVGHLDTRVGREVTKLGEMLSQLPGVVGCRTDAQVAIIFDQQNRWALDDA
QGPRNLGMEYENTVNEHYRPFWEQGIAVDIIDADVDLSAYRLVIAPMLYMVRDGFAERAE
AFVANGGHLVTTYWTGIVNESDLCYLGGFPGPLRKLLGIWAEEIDCLNDGERNLVQGLAG
NEGGLQGPYQVRHLCELIHAETAQPLATYRDDFYAGRPAVTVNHVGKGKAWHVASRNDLA
FQRDFFSAISKELALPRAVEADFPPGVVATARTDGETTYVFLQNYSAQQQQVTLPQGYQD
TLTGTALNAPLILKAWDCRILSRHA
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory