SitesBLAST
Comparing BWI76_RS07225 FitnessBrowser__Koxy:BWI76_RS07225 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
3ceaA Crystal structure of myo-inositol 2-dehydrogenase (np_786804.1) from lactobacillus plantarum at 2.40 a resolution
26% identity, 98% coverage: 4:332/335 of query aligns to 5:341/342 of 3ceaA
- active site: K98 (= K94), H185 (= H175)
- binding nicotinamide-adenine-dinucleotide: G11 (= G10), G13 (= G12), R14 (≠ F13), L15 (≠ I14), L38 (vs. gap), Q42 (≠ R40), V74 (≠ A70), A75 (≠ S71), P76 (≠ S72), T77 (= T73), F79 (≠ S75), H80 (= H76), M83 (≠ L79), E97 (= E93), K98 (= K94), M127 (≠ N122), F169 (vs. gap), H185 (= H175), F286 (≠ W276)
3nt5A Crystal structure of myo-inositol dehydrogenase from bacillus subtilis with bound cofactor and product inosose (see paper)
24% identity, 98% coverage: 4:332/335 of query aligns to 3:328/337 of 3nt5A
- active site: K97 (= K94), H176 (= H175)
- binding (2R,3S,4s,5R,6S)-2,3,4,5,6-pentahydroxycyclohexanone: K97 (= K94), H155 (≠ C151), H176 (= H175), Y235 (= Y236)
- binding nicotinamide-adenine-dinucleotide: G9 (= G10), G11 (= G12), A12 (≠ F13), I13 (= I14), D35 (= D35), V36 (≠ A36), S74 (= S71), W75 (≠ S72), G76 (≠ T73), E96 (= E93), K97 (= K94), Y280 (= Y284)
3nt4A Crystal structure of myo-inositol dehydrogenase from bacillus subtilis with bound cofactor nadh and inositol (see paper)
24% identity, 98% coverage: 4:332/335 of query aligns to 3:328/337 of 3nt4A
- active site: K97 (= K94), H176 (= H175)
- binding 1,2,3,4,5,6-hexahydroxy-cyclohexane: H155 (≠ C151), H176 (= H175), Y235 (= Y236), W272 (= W276)
- binding 1,4-dihydronicotinamide adenine dinucleotide: G11 (= G12), A12 (≠ F13), I13 (= I14), D35 (= D35), V36 (≠ A36), S74 (= S71), W75 (≠ S72), G76 (≠ T73), E96 (= E93), K97 (= K94), H176 (= H175)
3nt2B Crystal structure of myo-inositol dehydrogenase from bacillus subtilis with bound cofactor (see paper)
24% identity, 98% coverage: 4:332/335 of query aligns to 3:328/337 of 3nt2B
- active site: K97 (= K94), H176 (= H175)
- binding 1,4-dihydronicotinamide adenine dinucleotide: G9 (= G10), G11 (= G12), A12 (≠ F13), D35 (= D35), V36 (≠ A36), S74 (= S71), W75 (≠ S72), A78 (≠ S75), K97 (= K94), W272 (= W276), Y280 (= Y284)
3nt2A Crystal structure of myo-inositol dehydrogenase from bacillus subtilis with bound cofactor (see paper)
24% identity, 98% coverage: 4:332/335 of query aligns to 3:328/337 of 3nt2A
- active site: K97 (= K94), H176 (= H175)
- binding nicotinamide-adenine-dinucleotide: G9 (= G10), G11 (= G12), A12 (≠ F13), I13 (= I14), D35 (= D35), V36 (≠ A36), S74 (= S71), W75 (≠ S72), G76 (≠ T73), A78 (≠ S75), H79 (= H76), E96 (= E93), K97 (= K94), H176 (= H175), Y280 (= Y284)
4l8vA Crystal structure of a12k/d35s mutant myo-inositol dehydrogenase from bacillus subtilis with bound cofactor NADP (see paper)
24% identity, 98% coverage: 4:332/335 of query aligns to 3:328/337 of 4l8vA
- active site: K97 (= K94), H176 (= H175)
- binding nadp nicotinamide-adenine-dinucleotide phosphate: K12 (≠ F13), I13 (= I14), S74 (= S71), W75 (≠ S72), H79 (= H76), E96 (= E93), K97 (= K94), M126 (≠ N122), W272 (= W276), Y280 (= Y284)
4n54A Crystal structure of scyllo-inositol dehydrogenase from lactobacillus casei with bound cofactor NAD(h) and scyllo-inositol
27% identity, 87% coverage: 3:295/335 of query aligns to 2:303/340 of 4n54A
- active site: K96 (= K94), H183 (= H175)
- binding (1r,2r,3r,4r,5r,6r)-cyclohexane-1,2,3,4,5,6-hexol: R12 (≠ F13), K96 (= K94), D156 (vs. gap), D179 (= D171), M180 (≠ Q172), H183 (= H175), R238 (= R230), Y244 (= Y236)
- binding 1,4-dihydronicotinamide adenine dinucleotide: V8 (≠ L9), G9 (= G10), L10 (≠ S11), G11 (= G12), R12 (≠ F13), L13 (≠ I14), S35 (≠ D35), V36 (≠ A36), E40 (≠ R40), S73 (= S71), P74 (≠ S72), F77 (≠ S75), H78 (= H76), E95 (= E93), K96 (= K94), M125 (≠ N122), F167 (≠ Y161), F284 (≠ Y273)
3q2kK Crystal structure of the wlba dehydrogenase from bordetella pertussis in complex with nadh and udp-glcnaca (see paper)
29% identity, 81% coverage: 4:275/335 of query aligns to 3:278/322 of 3q2kK
- active site: K95 (= K94), H183 (= H175)
- binding (2S,3S,4R,5R,6R)-5-acetamido-6-[[[(2R,3S,4R,5R)-5-(2,4-dioxopyrimidin-1-yl)-3,4-dihydroxy-oxolan-2-yl]methoxy-hydroxy-phosphoryl]oxy-hydroxy-phosphoryl]oxy-3,4-dihydroxy-oxane-2-carboxylic acid: R12 (≠ F13), K95 (= K94), T155 (≠ M156), R156 (≠ P157), Y160 (= Y161), N179 (≠ D171), Q180 (= Q172), H183 (= H175), N239 (≠ G235)
- binding 1,4-dihydronicotinamide adenine dinucleotide: G9 (= G10), G11 (= G12), R12 (≠ F13), I13 (= I14), D35 (= D35), T36 (≠ A36), T72 (≠ S71), P73 (≠ S72), S74 (≠ T73), L76 (≠ S75), H77 (= H76), E94 (= E93), K95 (= K94), Q123 (≠ N122), W166 (vs. gap), R167 (vs. gap), H183 (= H175)
3q2kC Crystal structure of the wlba dehydrogenase from bordetella pertussis in complex with nadh and udp-glcnaca (see paper)
29% identity, 78% coverage: 4:263/335 of query aligns to 8:272/347 of 3q2kC
- active site: K100 (= K94), H188 (= H175)
- binding (2S,3S,4R,5R,6R)-5-acetamido-6-[[[(2R,3S,4R,5R)-5-(2,4-dioxopyrimidin-1-yl)-3,4-dihydroxy-oxolan-2-yl]methoxy-hydroxy-phosphoryl]oxy-hydroxy-phosphoryl]oxy-3,4-dihydroxy-oxane-2-carboxylic acid: R17 (≠ F13), K100 (= K94), W159 (≠ I155), T160 (≠ M156), R161 (≠ P157), Y165 (= Y161), N184 (≠ D171), Q185 (= Q172), H188 (= H175), Q243 (≠ H234), N244 (≠ G235)
- binding 1,4-dihydronicotinamide adenine dinucleotide: G16 (= G12), R17 (≠ F13), I18 (= I14), D40 (= D35), T41 (≠ A36), A76 (= A70), T77 (≠ S71), S79 (≠ T73), H82 (= H76), Q85 (≠ L79), E99 (= E93), K100 (= K94), Q128 (≠ N122), W171 (vs. gap), R172 (vs. gap)
8qc8D Crystal structure of NAD-dependent glycoside hydrolase from flavobacterium sp. (Strain k172) in complex with co-factor NAD+ (see paper)
25% identity, 98% coverage: 4:331/335 of query aligns to 2:338/339 of 8qc8D
- binding nicotinamide-adenine-dinucleotide: G10 (= G12), H11 (≠ F13), M12 (≠ I14), D33 (= D35), P34 (≠ A36), T35 (≠ D37), S38 (≠ R40), A71 (= A70), S72 (= S71), P73 (≠ S72), N74 (≠ T73), H77 (= H76), E96 (= E93), K97 (= K94), E125 (≠ N122), K162 (≠ P158), V163 (≠ L159), W166 (vs. gap)
8qc8B Crystal structure of NAD-dependent glycoside hydrolase from flavobacterium sp. (Strain k172) in complex with co-factor NAD+ (see paper)
26% identity, 74% coverage: 3:251/335 of query aligns to 5:269/367 of 8qc8B
- binding nicotinamide-adenine-dinucleotide: H15 (≠ F13), M16 (≠ I14), D37 (= D35), P38 (≠ A36), T39 (≠ D37), S42 (≠ R40), A75 (= A70), S76 (= S71), P77 (≠ S72), N78 (≠ T73), H81 (= H76), E100 (= E93), K101 (= K94), E129 (≠ N122), K166 (≠ P158), V167 (≠ L159), W170 (vs. gap)
Sites not aligning to the query:
8qc2A Crystal structure of NAD-dependent glycoside hydrolase from flavobacterium sp. (Strain k172) in complex with co-factor NAD+ and sulfoquinovose (sq) (see paper)
26% identity, 74% coverage: 3:251/335 of query aligns to 3:267/363 of 8qc2A
- binding nicotinamide-adenine-dinucleotide: G12 (= G12), H13 (≠ F13), M14 (≠ I14), D35 (= D35), P36 (≠ A36), T37 (≠ D37), S40 (≠ R40), A73 (= A70), S74 (= S71), P75 (≠ S72), N76 (≠ T73), H79 (= H76), E98 (= E93), K99 (= K94), E127 (≠ N122), K164 (≠ P158), V165 (≠ L159), W168 (vs. gap)
- binding sulfoquinovose: K99 (= K94), Y128 (≠ R123), R158 (= R152), F161 (≠ I155), L162 (≠ M156), K164 (≠ P158), E181 (≠ D171), H185 (= H175)
Sites not aligning to the query:
4koaA Crystal structure analysis of 1,5-anhydro-d-fructose reductase from sinorhizobium meliloti (see paper)
30% identity, 68% coverage: 4:232/335 of query aligns to 2:234/333 of 4koaA
- active site: K94 (= K94), H180 (= H175)
- binding nadph dihydro-nicotinamide-adenine-dinucleotide phosphate: G8 (= G10), A9 (≠ S11), S10 (≠ G12), T11 (≠ F13), I12 (= I14), S33 (≠ D35), S34 (≠ A36), R38 (= R40), T71 (≠ S71), N73 (≠ T73), H76 (= H76), K94 (= K94), Q160 (vs. gap)
3ec7A Crystal structure of putative dehydrogenase from salmonella typhimurium lt2
26% identity, 98% coverage: 4:332/335 of query aligns to 3:327/336 of 3ec7A
- active site: K97 (= K94), H176 (= H175)
- binding nicotinamide-adenine-dinucleotide: G11 (= G12), M12 (≠ F13), I13 (= I14), D35 (= D35), I36 (≠ A36), R40 (= R40), T73 (≠ A70), A74 (≠ S71), S75 (= S72), N76 (≠ T73), H79 (= H76), E96 (= E93), K97 (= K94), M126 (≠ N122), W271 (= W276), Y279 (= Y284)
8qc6A Crystal structure of NAD-dependent glycoside hydrolase from arthrobacter sp. U41 in complex with NAD+ and sulfoquinovose (sq) (see paper)
25% identity, 74% coverage: 4:250/335 of query aligns to 6:268/366 of 8qc6A
- binding nicotinamide-adenine-dinucleotide: H15 (≠ F13), M16 (≠ I14), D37 (= D35), P38 (≠ A36), S42 (≠ R40), A75 (= A70), S76 (= S71), P77 (≠ S72), N78 (≠ T73), H81 (= H76), E100 (= E93), K101 (= K94), E129 (≠ N122), K166 (≠ P158), V167 (≠ L159), W170 (vs. gap)
- binding sulfoquinovose: K101 (= K94), Y130 (≠ R123), R160 (= R152), F163 (≠ I155), L164 (≠ M156), K166 (≠ P158), E183 (≠ D171), K184 (≠ Q172), H187 (= H175)
Sites not aligning to the query:
2glxA Crystal structure analysis of bacterial 1,5-af reductase (see paper)
31% identity, 61% coverage: 29:232/335 of query aligns to 27:233/332 of 2glxA
- active site: K93 (= K94), H179 (= H175)
- binding acetate ion: K93 (= K94), H179 (= H175)
- binding nadph dihydro-nicotinamide-adenine-dinucleotide phosphate: S32 (≠ A34), T33 (≠ D35), R37 (= R40), S69 (≠ A70), T70 (≠ S71), N72 (≠ T73), H75 (= H76), E92 (= E93), K93 (= K94), H121 (≠ N122), W161 (vs. gap), R162 (vs. gap)
Sites not aligning to the query:
6jw8A The crystal structure of kand2 in complex with nadh and 3"-deamino-3"- hydroxykanamycin b (see paper)
28% identity, 95% coverage: 4:322/335 of query aligns to 2:322/342 of 6jw8A
- binding (2S,3R,4S,5S,6R)-2-[(1S,2S,3R,4S,6R)-3-[(2R,3R,4R,5S,6R)-6-(aminomethyl)-3-azanyl-4,5-bis(oxidanyl)oxan-2-yl]oxy-4,6-bis(azanyl)-2-oxidanyl-cyclohexyl]oxy-6-(hydroxymethyl)oxane-3,4,5-triol: F11 (= F13), F152 (≠ C151), N154 (≠ A153), D175 (= D171), L176 (≠ Q172), H179 (= H175), E236 (≠ Y236), W271 (= W262)
- binding 1,4-dihydronicotinamide adenine dinucleotide: G10 (= G12), F11 (= F13), M12 (≠ I14), D33 (= D35), L34 (≠ A36), T70 (≠ A70), T71 (≠ S71), P72 (≠ S72), N73 (≠ T73), L75 (≠ S75), H76 (= H76), Q79 (≠ L79), E93 (= E93), K94 (= K94), N122 (≠ P116), W161 (≠ Y161), H179 (= H175), Y290 (= Y285)
6jw7A The crystal structure of kand2 in complex with nadh and 3"-deamino-3"- hydroxykanamycin a (see paper)
28% identity, 95% coverage: 4:322/335 of query aligns to 2:322/342 of 6jw7A
- binding (2R,3S,4S,5R,6R)-2-(aminomethyl)-6-[(1R,2S,3S,4R,6S)-4,6-bis(azanyl)-3-[(2S,3R,4S,5S,6R)-6-(hydroxymethyl)-3,4,5-tris(oxidanyl)oxan-2-yl]oxy-2-oxidanyl-cyclohexyl]oxy-oxane-3,4,5-triol: F11 (= F13), N154 (≠ A153), D175 (= D171), H179 (= H175), E236 (≠ Y236), W271 (= W262)
- binding 1,4-dihydronicotinamide adenine dinucleotide: G8 (= G10), G10 (= G12), F11 (= F13), M12 (≠ I14), D33 (= D35), L34 (≠ A36), T70 (≠ A70), T71 (≠ S71), P72 (≠ S72), N73 (≠ T73), L75 (≠ S75), H76 (= H76), Q79 (≠ L79), E93 (= E93), K94 (= K94), N122 (≠ P116), W161 (≠ Y161), Y290 (= Y285)
6jw6A The crystal structure of kand2 in complex with NAD (see paper)
28% identity, 95% coverage: 4:322/335 of query aligns to 2:322/341 of 6jw6A
- binding nicotinamide-adenine-dinucleotide: G10 (= G12), F11 (= F13), M12 (≠ I14), D33 (= D35), L34 (≠ A36), T70 (≠ A70), T71 (≠ S71), P72 (≠ S72), N73 (≠ T73), L75 (≠ S75), H76 (= H76), Q79 (≠ L79), E93 (= E93), K94 (= K94), N122 (≠ P116), W161 (≠ Y161), H179 (= H175), Y290 (= Y285)
Q2I8V6 1,5-anhydro-D-fructose reductase; Anhydrofructose reductase; 1,5-anhydro-D-fructose reductase (1,5-anhydro-D-mannitol-forming); EC 1.1.1.292 from Ensifer adhaerens (Sinorhizobium morelense) (see paper)
30% identity, 61% coverage: 29:232/335 of query aligns to 28:234/333 of Q2I8V6
- S33 (≠ A34) mutation to D: No activity.
- ST 33:34 (≠ AD 34:35) binding
- R38 (= R40) binding
- TTNELH 71:76 (≠ SSTPSH 71:76) binding
- EK 93:94 (= EK 93:94) binding
- K94 (= K94) mutation to G: Less than 1% remaining activity.
- N120 (≠ G120) binding
- WR 162:163 (vs. gap) binding
- D176 (= D171) mutation to A: Less than 1% remaining activity.
- H180 (= H175) mutation to A: Less than 2% remaining activity.
- G206 (≠ A201) mutation to I: No effect.
Sites not aligning to the query:
- 9:12 binding
- 10 S→G: Almost no effect.
- 13 A→G: Can use NAD as cosubstrate as well as NADP.
- 283 binding
Query Sequence
>BWI76_RS07225 FitnessBrowser__Koxy:BWI76_RS07225
MTCIRFALLGSGFIGQVHAASLARHERTVLSMVADADPERAKALASRYGARAVTVAEAIN
SDAIDAVLIASSTPSHAALLAAAARAGKAVYCEKPIDLSLARARQVVEKVLPLGVPVTVG
FNRRFDASHQQLRREIEAGVIGKIELVQMVCRASIMPPLEYLRSSGGQMRDQAIHFFDLL
RFLTGDEVTTVAAMGDALALAEIAEFDDVDTSILMLRMRGGAMAQLDNTRRTGHGYDERI
SLLGSDGVLESGSQTTRGVTLWQGERRIQPGLYPDWFSRVEGSYYAHLDAFVRSLGGEEV
ADLPGLLDGLRAQAIAEAAVLSLQQGQFVSVEPLA
Or try a new SitesBLAST search
SitesBLAST's Database
SitesBLAST's database includes
(1) SwissProt
entries with experimentally-supported functional features;
and (2) protein structures with bound ligands, from the
BioLip database.
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory