Comparing BWI76_RS07240 BWI76_RS07240 D-ribose transporter ATP-binding protein to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
P04983 Ribose import ATP-binding protein RbsA; EC 7.5.2.7 from Escherichia coli (strain K12) (see paper)
49% identity, 99% coverage: 6:492/494 of query aligns to 5:491/501 of P04983
4u00A Crystal structure of ttha1159 in complex with adp (see paper)
32% identity, 45% coverage: 11:230/494 of query aligns to 8:226/241 of 4u00A
3c4jA Abc protein artp in complex with atp-gamma-s
31% identity, 43% coverage: 11:220/494 of query aligns to 9:216/242 of 3c4jA
3c41J Abc protein artp in complex with amp-pnp/mg2+
31% identity, 43% coverage: 11:220/494 of query aligns to 9:216/242 of 3c41J
2olkA Abc protein artp in complex with adp-beta-s
31% identity, 43% coverage: 11:220/494 of query aligns to 9:216/242 of 2olkA
2oljA Abc protein artp in complex with adp/mg2+
31% identity, 43% coverage: 11:220/494 of query aligns to 9:216/242 of 2oljA
4ymuJ Crystal structure of an amino acid abc transporter complex with arginines and atps (see paper)
29% identity, 43% coverage: 11:220/494 of query aligns to 7:215/240 of 4ymuJ
P30750 Methionine import ATP-binding protein MetN; EC 7.4.2.11 from Escherichia coli (strain K12) (see 3 papers)
30% identity, 47% coverage: 18:249/494 of query aligns to 18:240/343 of P30750
Sites not aligning to the query:
3tuzC Inward facing conformations of the metni methionine abc transporter: cy5 semet soak crystal form (see paper)
29% identity, 47% coverage: 18:249/494 of query aligns to 19:241/344 of 3tuzC
Sites not aligning to the query:
3tuiC Inward facing conformations of the metni methionine abc transporter: cy5 native crystal form (see paper)
29% identity, 47% coverage: 18:249/494 of query aligns to 19:241/344 of 3tuiC
Sites not aligning to the query:
6cvlD Crystal structure of the escherichia coli atpgs-bound metni methionine abc transporter in complex with its metq binding protein (see paper)
29% identity, 47% coverage: 18:249/494 of query aligns to 19:241/344 of 6cvlD
Sites not aligning to the query:
1g6hA Crystal structure of the adp conformation of mj1267, an atp-binding cassette of an abc transporter (see paper)
27% identity, 46% coverage: 6:233/494 of query aligns to 5:242/254 of 1g6hA
1g9xB Characterization of the twinning structure of mj1267, an atp-binding cassette of an abc transporter (see paper)
27% identity, 46% coverage: 6:233/494 of query aligns to 5:242/253 of 1g9xB
5x40A Structure of a cbio dimer bound with amppcp (see paper)
32% identity, 43% coverage: 6:217/494 of query aligns to 5:216/280 of 5x40A
3fvqB Crystal structure of the nucleotide binding domain fbpc complexed with atp (see paper)
31% identity, 46% coverage: 5:231/494 of query aligns to 3:228/350 of 3fvqB
P75831 Macrolide export ATP-binding/permease protein MacB; EC 7.6.2.- from Escherichia coli (strain K12) (see paper)
30% identity, 43% coverage: 6:217/494 of query aligns to 5:219/648 of P75831
P9WQK5 Uncharacterized ABC transporter ATP-binding protein Rv0073 from Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) (see paper)
28% identity, 38% coverage: 11:199/494 of query aligns to 10:201/330 of P9WQK5
6z4wA Ftse structure from streptococcus pneumoniae in complex with adp (space group p 1) (see paper)
27% identity, 44% coverage: 11:228/494 of query aligns to 10:226/230 of 6z4wA
6z67B Ftse structure of streptococcus pneumoniae in complex with amppnp at 2.4 a resolution (see paper)
27% identity, 44% coverage: 11:228/494 of query aligns to 10:226/229 of 6z67B
1ji0A Crystal structure analysis of the abc transporter from thermotoga maritima
26% identity, 47% coverage: 6:236/494 of query aligns to 7:234/240 of 1ji0A
>BWI76_RS07240 BWI76_RS07240 D-ribose transporter ATP-binding protein
MNAFALEAEGISKFFPGVKALDNVSLRVRPGTVHALMGENGAGKSTLMKCLIGIYRPDKG
AIRVKGEPVQFQDTMDALRSGISMIHQELNLVPHMTVAENIWLGREPMKYGFVDHRQLAR
QTQDLLDKLNIRLSADRLVGELSIASQQMVEIAKAVSWNADIVIMDEPTSALTESEVAHL
FTIIRDLRQQGKAIIYISHKMDEIFAITDEISVFRDGTWVGSKQTTEFTRQSLITQMVGR
ELTQLFPKFNNAIGEEVLTVRNLSRKGAFHDINFSVRRGEILGVAGLVGAGRSEVMESLF
GMEKADSGEVLIDGMPVNIDSPSTAIEKGMALLTEDRKKSGLFLVLSVLENMSIVKMPEY
IGKTGFVQHLKMAEDCMEQIRRLNIKTPTMDQIINNLSGGNQQKVLIARWLLAQPKILIL
DEPTRGIDVGAKAEIYHLISELANRGVAVIMVSSELPEILGMSDRVMVMHEGRITGILDK
EDADQETILSLASH
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory