Comparing BWI76_RS07310 FitnessBrowser__Koxy:BWI76_RS07310 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
7vcpA Frischella perrara beta-fructofuranosidase in complex with fructose (see paper)
35% identity, 96% coverage: 2:447/466 of query aligns to 2:467/490 of 7vcpA
6nu8A Structure of sucrose-6-phosphate hydrolase from lactobacillus gasseri in complex with fructose
34% identity, 93% coverage: 12:446/466 of query aligns to 17:469/488 of 6nu8A
7bwcA Bombyx mori gh32 beta-fructofuranosidase bmsuc1 mutant d63a in complex with sucrose (see paper)
35% identity, 92% coverage: 11:438/466 of query aligns to 9:436/464 of 7bwcA
O33833 Beta-fructosidase; Invertase; Sucrase; EC 3.2.1.26 from Thermotoga maritima (strain ATCC 43589 / DSM 3109 / JCM 10099 / NBRC 100826 / MSB8) (see paper)
34% identity, 86% coverage: 28:428/466 of query aligns to 4:396/432 of O33833
1w2tB Beta-fructosidase from thermotoga maritima in complex with raffinose (see paper)
33% identity, 86% coverage: 28:428/466 of query aligns to 4:396/432 of 1w2tB
1w2tA Beta-fructosidase from thermotoga maritima in complex with raffinose (see paper)
33% identity, 86% coverage: 28:428/466 of query aligns to 4:396/432 of 1w2tA
6nunA Structure of gh32 hydrolase from bifidobacterium adolescentis in complex with frutose
31% identity, 89% coverage: 27:440/466 of query aligns to 38:485/516 of 6nunA
3pijB Beta-fructofuranosidase from bifidobacterium longum - complex with fructose (see paper)
30% identity, 89% coverage: 27:440/466 of query aligns to 40:487/526 of 3pijB
2qquA Crystal structure of a cell-wall invertase (d239a) from arabidopsis thaliana in complex with sucrose (see paper)
29% identity, 68% coverage: 30:346/466 of query aligns to 8:341/535 of 2qquA
Sites not aligning to the query:
2ac1A Crystal structure of a cell-wall invertase from arabidopsis thaliana (see paper)
29% identity, 68% coverage: 30:346/466 of query aligns to 8:341/537 of 2ac1A
Sites not aligning to the query:
Q43866 Beta-fructofuranosidase, insoluble isoenzyme CWINV1; Cell wall beta-fructosidase 1; AtbetaFRUCT1; Cell wall invertase 1; AtcwINV1; Sucrose hydrolase 1; EC 3.2.1.26 from Arabidopsis thaliana (Mouse-ear cress) (see 5 papers)
29% identity, 68% coverage: 30:346/466 of query aligns to 55:388/584 of Q43866
2oxbA Crystal structure of a cell-wall invertase (e203q) from arabidopsis thaliana in complex with sucrose (see paper)
29% identity, 68% coverage: 30:346/466 of query aligns to 8:341/537 of 2oxbA
O94220 Extracellular endo-inulinase inu2; 2,1-beta-D-fructanfructanohydrolase; Inulase; EC 3.2.1.7 from Aspergillus ficuum (see 2 papers)
26% identity, 90% coverage: 20:440/466 of query aligns to 22:488/516 of O94220
3rwkX First crystal structure of an endo-inulinase, from aspergillus ficuum: structural analysis and comparison with other gh32 enzymes. (see paper)
26% identity, 90% coverage: 23:440/466 of query aligns to 2:465/493 of 3rwkX
Q39041 Acid beta-fructofuranosidase 4, vacuolar; At beta fruct4; AtBETAFRUCT4; Acid invertase 4; AI 4; Acid sucrose hydrolase 4; Vacuolar invertase 4; Inv-V4; VAC-INV 4; VI 4; EC 3.2.1.26 from Arabidopsis thaliana (Mouse-ear cress) (see 2 papers)
24% identity, 83% coverage: 30:414/466 of query aligns to 124:519/664 of Q39041
Sites not aligning to the query:
2aeyA Crystal structure of fructan 1-exohydrolase iia from cichorium intybus in complex with 2,5 dideoxy-2,5-immino-d-mannitol (see paper)
28% identity, 74% coverage: 30:376/466 of query aligns to 10:370/537 of 2aeyA
2addA Crystal structure of fructan 1-exohydrolase iia from cichorium intybus in complex with sucrose (see paper)
28% identity, 74% coverage: 30:376/466 of query aligns to 10:370/537 of 2addA
8betA Structure of d188a-fructofuranosidase from rhodotorula dairenesis in complex with sucrose (see paper)
25% identity, 94% coverage: 4:442/466 of query aligns to 4:497/525 of 8betA
8besA Structure of d188a-fructofuranosidase from rhodotorula dairenensis in complex with fructose (see paper)
25% identity, 94% coverage: 4:442/466 of query aligns to 4:498/526 of 8besA
8beqA Structure of fructofuranosidase from rhodotorula dairenensis (see paper)
31% identity, 47% coverage: 4:222/466 of query aligns to 6:227/534 of 8beqA
Sites not aligning to the query:
>BWI76_RS07310 FitnessBrowser__Koxy:BWI76_RS07310
MSLPSRLPAILQAVMQGQPRALADSHYPRWHHAPVTGLMNDPNGFVEFAGRYHLFYQWNP
LACDHKFKCWAHWSSDDLLRWRHEPIALMPDEEYDRNGCYSGSAVDNNGTLTLCYTGNVK
FDDGGRTAWQCLATENADGTFTKLGPVLPLPEGYTGHVRDPKVWRHQDRWYMVLGAQDRQ
KRGKVLLFSSPDLHQWRSEGEIAGDGINGLSDAGYMWECPDLFALGDQHILICCPQGIAR
EEERFLNTYPAVWMAGGFDYDRAAFSHGELRELDAGFEFYAPQTTHTRDGRRLLVGWMGV
PDGEEMRQPTLAHGWIHQMTCLRELEFIDGQLYQRPLRELTALRGEAHGWQGNALPLAPM
EIALQTAADDALSLDFGGALTLERDASGIRLARRSLVSDEMHYRYWRGEVRTLRIFFDRS
SVEIFINDGEGVMSSRCFPAYPAQLIFSGSAPDAFCYWPLRTCMVE
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory