SitesBLAST
Comparing BWI76_RS07455 FitnessBrowser__Koxy:BWI76_RS07455 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
8dorA Crystal structure of dihydropteridine reductase/oxygen-insensitive NAD(p)h nitroreductase from klebsiella pneumoniae
94% identity, 100% coverage: 1:217/217 of query aligns to 1:217/217 of 8dorA
- binding flavin mononucleotide: R10 (= R10), Y11 (= Y11), S12 (= S12), K14 (= K14), P38 (= P38), S39 (= S39), S40 (= S40), N42 (= N42), N71 (= N71), K74 (= K74), P163 (= P163), I164 (= I164), E165 (= E165), G166 (= G166), K205 (= K205), R207 (= R207)
Q01234 Oxygen-insensitive NAD(P)H nitroreductase; NR; EC 1.-.-.- from Enterobacter cloacae (see paper)
85% identity, 100% coverage: 1:217/217 of query aligns to 1:217/217 of Q01234
5j8gA Structure of nitroreductase from e. Cloacae complexed with para- nitrobenzoic acid (see paper)
85% identity, 100% coverage: 2:217/217 of query aligns to 1:216/216 of 5j8gA
- active site: K13 (= K14), K73 (= K74), E164 (= E165)
- binding 4-nitrobenzoic acid: S39 (= S40), T40 (= T41), F123 (= F124), E164 (= E165), G165 (= G166)
- binding flavin mononucleotide: R9 (= R10), H10 (≠ Y11), S11 (= S12), K13 (= K14), S38 (= S39), S39 (= S40), N41 (= N42), N70 (= N71), K73 (= K74), P162 (= P163), I163 (= I164), E164 (= E165), G165 (= G166), K204 (= K205), R206 (= R207)
5j8dA Structure of nitroreductase from e. Cloacae complexed with nicotinic acid adenine dinucleotide (see paper)
85% identity, 100% coverage: 2:217/217 of query aligns to 1:216/216 of 5j8dA
- active site: K13 (= K14), K73 (= K74), E164 (= E165)
- binding nicotinic acid adenine dinucleotide: K13 (= K14), S39 (= S40), T40 (= T41), N70 (= N71), K73 (= K74), R106 (= R107), F107 (= F108), F123 (= F124), G165 (= G166), F198 (= F199), L202 (= L203)
- binding flavin mononucleotide: R9 (= R10), H10 (≠ Y11), S11 (= S12), K13 (= K14), P37 (= P38), S38 (= S39), S39 (= S40), N41 (= N42), N70 (= N71), P162 (= P163), I163 (= I164), E164 (= E165), G165 (= G166), K204 (= K205), R206 (= R207)
1kqcA Structure of nitroreductase from e. Cloacae complex with inhibitor acetate (see paper)
85% identity, 100% coverage: 2:217/217 of query aligns to 1:216/216 of 1kqcA
- active site: K13 (= K14), K73 (= K74), E164 (= E165)
- binding acetate ion: T40 (= T41), F123 (= F124)
- binding flavin mononucleotide: R9 (= R10), H10 (≠ Y11), S11 (= S12), K13 (= K14), P37 (= P38), S38 (= S39), S39 (= S40), N41 (= N42), N70 (= N71), P162 (= P163), I163 (= I164), E164 (= E165), G165 (= G166), K204 (= K205), R206 (= R207)
1ooqA Nitroreductase from e-coli in complex with the inhibitor dicoumarol (see paper)
84% identity, 100% coverage: 1:217/217 of query aligns to 1:217/217 of 1ooqA
- active site: K14 (= K14), K74 (= K74), E165 (= E165)
- binding bishydroxy[2h-1-benzopyran-2-one,1,2-benzopyrone]: K14 (= K14), F70 (= F70)
- binding flavin mononucleotide: R10 (= R10), H11 (≠ Y11), S12 (= S12), K14 (= K14), S39 (= S39), S40 (= S40), N42 (= N42), N71 (= N71), K74 (= K74), P163 (= P163), I164 (= I164), E165 (= E165), G166 (= G166), K205 (= K205), R207 (= R207)
1oo6A Nitroreductase from e-coli in complex with the dinitrobenzamide prodrug sn23862 (see paper)
84% identity, 100% coverage: 1:217/217 of query aligns to 1:217/217 of 1oo6A
- active site: K14 (= K14), K74 (= K74), E165 (= E165)
- binding flavin mononucleotide: R10 (= R10), H11 (≠ Y11), S12 (= S12), K14 (= K14), S39 (= S39), S40 (= S40), N42 (= N42), N71 (= N71), P163 (= P163), I164 (= I164), E165 (= E165), G166 (= G166), K205 (= K205), R207 (= R207)
- binding 5-[bis-2(chloro-ethyl)-amino]-2,4-dintro-benzamide: K14 (= K14), T41 (= T41), F70 (= F70), K119 (= K119), G120 (= G120), F124 (= F124), F199 (= F199)
1idtA Structural studies on a prodrug-activating system-cb1954 and fmn- dependent nitroreductase (see paper)
84% identity, 100% coverage: 1:217/217 of query aligns to 1:217/217 of 1idtA
- active site: K14 (= K14), K74 (= K74), E165 (= E165)
- binding 5-(aziridin-1-yl)-2,4-dinitrobenzamide: K14 (= K14), T41 (= T41), F70 (= F70), F124 (= F124)
- binding flavin mononucleotide: R10 (= R10), H11 (≠ Y11), S12 (= S12), K14 (= K14), S39 (= S39), S40 (= S40), N42 (= N42), N71 (= N71), K74 (= K74), P163 (= P163), I164 (= I164), E165 (= E165), G166 (= G166), K205 (= K205), R207 (= R207)
1ds7A A minor fmn-dependent nitroreductase from escherichia coli b (see paper)
84% identity, 100% coverage: 1:217/217 of query aligns to 1:217/217 of 1ds7A
- active site: K14 (= K14), K74 (= K74), E165 (= E165)
- binding flavin mononucleotide: R10 (= R10), H11 (≠ Y11), S12 (= S12), K14 (= K14), S39 (= S39), S40 (= S40), T41 (= T41), N42 (= N42), P163 (= P163), E165 (= E165), K205 (= K205), R207 (= R207)
P38489 Oxygen-insensitive NAD(P)H nitroreductase; Dihydropteridine reductase; FMN-dependent nitroreductase; EC 1.-.-.-; EC 1.5.1.34 from Escherichia coli (strain K12) (see 3 papers)
84% identity, 100% coverage: 1:217/217 of query aligns to 1:217/217 of P38489
7xwwA Crystal structure of ntr in complex with bn-xb
84% identity, 100% coverage: 2:217/217 of query aligns to 1:216/216 of 7xwwA
- binding flavin mononucleotide: R9 (= R10), H10 (≠ Y11), S11 (= S12), P37 (= P38), S38 (= S39), S39 (= S40), N41 (= N42), N70 (= N71), P162 (= P163), I163 (= I164), E164 (= E165), K204 (= K205), R206 (= R207)
- binding 2,2-bis(fluoranyl)-4,6,10,12-tetramethyl-8-[1-[(4-nitrophenyl)methyl]pyridin-1-ium-4-yl]-3-aza-1-azonia-2-boranuidatricyclo[7.3.0.0^{3,7}]dodeca-1(12),4,6,8,10-pentaene: T40 (= T41), E101 (= E102), R106 (= R107), F107 (= F108), N116 (= N117)
7x32A Crystal structure of e. Coli nfsb in complex with berberine (see paper)
84% identity, 100% coverage: 2:217/217 of query aligns to 1:216/216 of 7x32A
- binding berberine: K13 (= K14), F69 (= F70)
- binding flavin mononucleotide: R9 (= R10), H10 (≠ Y11), S11 (= S12), K13 (= K14), P37 (= P38), S38 (= S39), S39 (= S40), N41 (= N42), N70 (= N71), P162 (= P163), I163 (= I164), E164 (= E165), G165 (= G166), K204 (= K205), R206 (= R207)
1ylrA The structure of e.Coli nitroreductase with bound acetate, crystal form 1 (see paper)
84% identity, 100% coverage: 2:217/217 of query aligns to 1:216/216 of 1ylrA
- active site: K13 (= K14), K73 (= K74), E164 (= E165)
- binding acetate ion: T40 (= T41), F123 (= F124)
- binding flavin mononucleotide: R9 (= R10), H10 (≠ Y11), S11 (= S12), K13 (= K14), P37 (= P38), S38 (= S39), S39 (= S40), N41 (= N42), N70 (= N71), P162 (= P163), I163 (= I164), E164 (= E165), G165 (= G166), K204 (= K205), R206 (= R207)
1ykiA The structure of e. Coli nitroreductase bound with the antibiotic nitrofurazone (see paper)
84% identity, 100% coverage: 2:217/217 of query aligns to 1:216/216 of 1ykiA
- active site: K13 (= K14), K73 (= K74), E164 (= E165)
- binding flavin mononucleotide: R9 (= R10), H10 (≠ Y11), S11 (= S12), K13 (= K14), P37 (= P38), S38 (= S39), S39 (= S40), N41 (= N42), N70 (= N71), P162 (= P163), I163 (= I164), E164 (= E165), G165 (= G166), K204 (= K205), R206 (= R207)
- binding nitrofurazone: T40 (= T41), Y67 (= Y68), F69 (= F70), N70 (= N71), F123 (= F124)
1oonA Nitroreductase from e-coli in complex with the dinitrobenzamide prodrug sn27217 (see paper)
84% identity, 100% coverage: 2:217/217 of query aligns to 1:216/216 of 1oonA
- active site: K13 (= K14), K73 (= K74), E164 (= E165)
- binding 2,4-dinitro,5-[bis(2-bromoethyl)amino]-n-(2',3'-dioxopropyl)benzamide: T40 (= T41), E101 (= E102), N116 (= N117), F123 (= F124)
- binding flavin mononucleotide: R9 (= R10), H10 (≠ Y11), S11 (= S12), K13 (= K14), S38 (= S39), S39 (= S40), N41 (= N42), N70 (= N71), L144 (= L145), P162 (= P163), I163 (= I164), E164 (= E165), G165 (= G166), K204 (= K205), R206 (= R207)
1icrA The structure of escherichia coli nitroreductase complexed with nicotinic acid (see paper)
84% identity, 100% coverage: 2:217/217 of query aligns to 1:216/216 of 1icrA
- active site: K13 (= K14), K73 (= K74), E164 (= E165)
- binding flavin mononucleotide: R9 (= R10), H10 (≠ Y11), S11 (= S12), K13 (= K14), P37 (= P38), S38 (= S39), S39 (= S40), N41 (= N42), N70 (= N71), K73 (= K74), P162 (= P163), I163 (= I164), E164 (= E165), G165 (= G166), K204 (= K205), R206 (= R207)
- binding nicotinic acid: S39 (= S40), T40 (= T41), F123 (= F124)
6czpA 2.2 angstrom resolution crystal structure oxygen-insensitive NAD(p)h- dependent nitroreductase nfsb from vibrio vulnificus in complex with fmn
61% identity, 100% coverage: 1:217/217 of query aligns to 3:219/219 of 6czpA
- active site: K16 (= K14), K76 (= K74), E167 (= E165)
- binding flavin mononucleotide: R12 (= R10), Y13 (= Y11), S14 (= S12), K16 (= K14), S41 (= S39), S42 (= S40), N44 (= N42), N73 (= N71), K76 (= K74), P165 (= P163), I166 (= I164), E167 (= E165), G168 (= G166), K207 (= K205), R209 (= R207)
7uwtB Structure of oxygen-insensitive NAD(p)h-dependent nitroreductase nfsb_vv f70a/f108y (ntr 2.0) in complex with fmn at 1.85 angstroms resolution (see paper)
60% identity, 100% coverage: 1:217/217 of query aligns to 1:217/217 of 7uwtB
- binding flavin mononucleotide: R10 (= R10), Y11 (= Y11), S12 (= S12), K14 (= K14), N71 (= N71), K74 (= K74), P163 (= P163), I164 (= I164), E165 (= E165), G166 (= G166), K205 (= K205), R207 (= R207)
- binding polyethylene glycol: M1 (= M1), E54 (≠ D54), L76 (= L76), D77 (= D77), E158 (≠ G158), D197 (≠ E197)
1v5zA Binding of coumarins to NAD(p)h:fmn oxidoreductase
36% identity, 91% coverage: 10:207/217 of query aligns to 11:207/217 of 1v5zA
- active site: K15 (= K14), H75 (≠ K74), E164 (= E165)
- binding (2e)-3-(2-hydroxyphenyl)acrylic acid: S41 (= S40), I42 (≠ T41), F123 (≠ R129), E164 (= E165), G165 (= G166)
- binding flavin mononucleotide: R11 (= R10), Y12 (= Y11), T13 (≠ S12), K15 (= K14), A39 (≠ P38), S40 (= S39), S41 (= S40), N43 (= N42), N72 (= N71), T162 (≠ P163), M163 (≠ I164), E164 (= E165), K205 (= K205), R207 (= R207)
1v5yA Binding of coumarins to NAD(p)h:fmn oxidoreductase
36% identity, 91% coverage: 10:207/217 of query aligns to 11:207/217 of 1v5yA
- active site: K15 (= K14), H75 (≠ K74), E164 (= E165)
- binding 4-hydroxy-2h-chromen-2-one: S41 (= S40), I42 (≠ T41), F123 (≠ R129)
- binding flavin mononucleotide: R11 (= R10), Y12 (= Y11), T13 (≠ S12), K15 (= K14), A39 (≠ P38), S40 (= S39), S41 (= S40), N72 (= N71), T162 (≠ P163), M163 (≠ I164), E164 (= E165), G165 (= G166), K205 (= K205), R207 (= R207)
Query Sequence
>BWI76_RS07455 FitnessBrowser__Koxy:BWI76_RS07455
MDIVSVALKRYSTKAFDATKKLTAEQAENLKTLLQYSPSSTNSQPWHFIVASSDAGKARV
AKAASGTYVFNERKILDASHVVVFCAKTAMDDAWLERVVDQEEADGRFANAEAKAANHKG
RTFFADMHRKELHDDDQWMAKQVYLNVGNFLLGVAAMGLDAVPIEGVDFAILDAEFDLKA
QGYTSLVVVPVGHHSVEDFNAALPKSRLPQATTITEI
Or try a new SitesBLAST search
SitesBLAST's Database
SitesBLAST's database includes
(1) SwissProt
entries with experimentally-supported functional features;
and (2) protein structures with bound ligands, from the
BioLip database.
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory