Comparing BWI76_RS07535 FitnessBrowser__Koxy:BWI76_RS07535 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
Q8RDH4 Dipeptide transport ATP-binding protein DppD; EC 7.4.2.9 from Caldanaerobacter subterraneus subsp. tengcongensis (strain DSM 15242 / JCM 11007 / NBRC 100824 / MB4) (Thermoanaerobacter tengcongensis) (see paper)
37% identity, 86% coverage: 37:333/347 of query aligns to 21:324/326 of Q8RDH4
4fwiB Crystal structure of the nucleotide-binding domain of a dipeptide abc transporter (see paper)
38% identity, 83% coverage: 37:325/347 of query aligns to 20:305/310 of 4fwiB
Sites not aligning to the query:
P0AAH4 Putrescine export system ATP-binding protein SapD from Escherichia coli (strain K12) (see paper)
36% identity, 90% coverage: 15:325/347 of query aligns to 2:321/330 of P0AAH4
P69874 Spermidine/putrescine import ATP-binding protein PotA; EC 7.6.2.11 from Escherichia coli (strain K12) (see 3 papers)
38% identity, 73% coverage: 15:266/347 of query aligns to 16:251/378 of P69874
Sites not aligning to the query:
4ymuJ Crystal structure of an amino acid abc transporter complex with arginines and atps (see paper)
35% identity, 72% coverage: 16:266/347 of query aligns to 1:239/240 of 4ymuJ
4u00A Crystal structure of ttha1159 in complex with adp (see paper)
36% identity, 73% coverage: 15:266/347 of query aligns to 1:239/241 of 4u00A
3c4jA Abc protein artp in complex with atp-gamma-s
37% identity, 66% coverage: 37:266/347 of query aligns to 16:241/242 of 3c4jA
Sites not aligning to the query:
3c41J Abc protein artp in complex with amp-pnp/mg2+
37% identity, 66% coverage: 37:266/347 of query aligns to 16:241/242 of 3c41J
Sites not aligning to the query:
2olkA Abc protein artp in complex with adp-beta-s
37% identity, 66% coverage: 37:266/347 of query aligns to 16:241/242 of 2olkA
Sites not aligning to the query:
2oljA Abc protein artp in complex with adp/mg2+
37% identity, 66% coverage: 37:266/347 of query aligns to 16:241/242 of 2oljA
Sites not aligning to the query:
P30750 Methionine import ATP-binding protein MetN; EC 7.4.2.11 from Escherichia coli (strain K12) (see 3 papers)
34% identity, 73% coverage: 16:270/347 of query aligns to 1:248/343 of P30750
Sites not aligning to the query:
7ahhC Opua inhibited inward-facing, sbd docked (see paper)
34% identity, 71% coverage: 42:286/347 of query aligns to 44:285/382 of 7ahhC
Sites not aligning to the query:
7aheC Opua inhibited inward facing (see paper)
34% identity, 71% coverage: 42:286/347 of query aligns to 44:285/382 of 7aheC
Sites not aligning to the query:
6cvlD Crystal structure of the escherichia coli atpgs-bound metni methionine abc transporter in complex with its metq binding protein (see paper)
33% identity, 73% coverage: 16:270/347 of query aligns to 2:249/344 of 6cvlD
3tuzC Inward facing conformations of the metni methionine abc transporter: cy5 semet soak crystal form (see paper)
33% identity, 73% coverage: 16:270/347 of query aligns to 2:249/344 of 3tuzC
Sites not aligning to the query:
3tuiC Inward facing conformations of the metni methionine abc transporter: cy5 native crystal form (see paper)
33% identity, 73% coverage: 16:270/347 of query aligns to 2:249/344 of 3tuiC
Q5M243 Energy-coupling factor transporter ATP-binding protein EcfA1; ECF transporter A component EcfA1; EC 7.-.-.- from Streptococcus thermophilus (strain ATCC BAA-250 / LMG 18311) (see paper)
39% identity, 62% coverage: 39:252/347 of query aligns to 19:226/276 of Q5M243
5x40A Structure of a cbio dimer bound with amppcp (see paper)
37% identity, 69% coverage: 15:255/347 of query aligns to 3:232/280 of 5x40A
7ahdC Opua (e190q) occluded (see paper)
35% identity, 64% coverage: 39:260/347 of query aligns to 41:260/260 of 7ahdC
Sites not aligning to the query:
7z15I E. Coli c-p lyase bound to a phnk/phnl dual abc dimer and adp + pi (see paper)
36% identity, 73% coverage: 14:266/347 of query aligns to 1:247/253 of 7z15I
>BWI76_RS07535 FitnessBrowser__Koxy:BWI76_RS07535
MQPFINIDLGGPAQPLLKVNNLLKHFPAGGGKAREVVQAVDDVSFAVIKGETLGVVGESG
CGKSTTARLLMQLLKQDSGELIFDGLEVGSSRLPMKAYRRQVQMVFQDSYASLNPRMTME
ESIAFGQRVHGVSAKEASEYARYLLAHVGLEPERFAHRYPHALSGGQRQRVNIARALAMK
PRLVILDEAVSALDKSVEAQVLQLLQELKRTLALTYVFISHDLHVVRWLSDRILVMYLGE
VVEIGPAEQLFTASAHPYTRALLSSMPSMDPHNRTLTSALNGDPPSPISPPSGCRFHTRC
PHARAVCAEVKPTLQSVGEGHQSACLMAQPASPWHQNIAIQEVSHVA
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory