SitesBLAST
Comparing BWI76_RS07600 BWI76_RS07600 aspartate aminotransferase family protein to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
6jixA The cyrstal structure of taurine:2-oxoglutarate aminotransferase from bifidobacterium kashiwanohense, in complex with plp and glutamate (see paper)
44% identity, 96% coverage: 11:438/445 of query aligns to 4:439/447 of 6jixA
- active site: W21 (= W28), Y141 (= Y148), D250 (= D253), K279 (= K282)
- binding glutamic acid: S20 (= S27), W21 (= W28), P82 (= P90), A83 (= A91), A83 (= A91), Y84 (≠ T92), L310 (= L313)
- binding pyridoxal-5'-phosphate: G114 (= G121), A115 (= A122), Y141 (= Y148), H142 (= H149), E217 (= E220), D250 (= D253), V252 (= V255), M253 (= M256), K279 (= K282), L310 (= L313), T311 (= T314)
6s54A Transaminase from pseudomonas fluorescens (see paper)
34% identity, 95% coverage: 16:437/445 of query aligns to 8:448/453 of 6s54A
- active site: M20 (≠ W28), Y152 (= Y148), D258 (= D253), K287 (= K282)
- binding pyridoxal-5'-phosphate: G119 (= G121), S120 (≠ A122), Y152 (= Y148), H153 (= H149), G154 (= G150), E225 (= E220), D258 (= D253), V260 (= V255), I261 (≠ M256), K287 (= K282)
6io1B Crystal structure of a novel thermostable (s)-enantioselective omega- transaminase from thermomicrobium roseum (see paper)
39% identity, 87% coverage: 36:422/445 of query aligns to 31:428/448 of 6io1B
- active site: Y151 (= Y148), D257 (= D253), K286 (= K282)
- binding 4'-deoxy-4'-aminopyridoxal-5'-phosphate: G117 (≠ A120), G118 (= G121), A119 (= A122), N122 (= N125), Y151 (= Y148), H152 (= H149), D257 (= D253), V259 (= V255), I260 (≠ M256), K286 (= K282)
Sites not aligning to the query:
5g0aA The crystal structure of a s-selective transaminase from bacillus megaterium (see paper)
34% identity, 95% coverage: 11:434/445 of query aligns to 2:456/468 of 5g0aA
- active site: F19 (≠ W28), Y142 (= Y148), E231 (= E220), D263 (= D253), L266 (≠ M256), K292 (= K282), R436 (≠ H414)
- binding pyridoxal-5'-phosphate: G115 (= G121), S116 (≠ A122), Y142 (= Y148), H143 (= H149), G144 (= G150), E231 (= E220), D263 (= D253), V265 (= V255), L266 (≠ M256), K292 (= K282)
5g09D The crystal structure of a s-selective transaminase from bacillus megaterium bound with r-alpha-methylbenzylamine (see paper)
34% identity, 95% coverage: 11:434/445 of query aligns to 7:461/473 of 5g09D
- active site: Y147 (= Y148), D268 (= D253), K297 (= K282)
- binding [6-methyl-5-oxidanyl-4-[(~{E})-[(1~{R})-1-phenylethyl]iminomethyl]pyridin-3-yl]methyl dihydrogen phosphate: Y59 (≠ V63), G120 (= G121), S121 (≠ A122), Y147 (= Y148), H148 (= H149), E236 (= E220), A241 (= A226), D268 (= D253), V270 (= V255), K297 (= K282)
6fyqA The crystal structure of a new transaminase from the marine bacterium virgibacillus (see paper)
34% identity, 94% coverage: 18:437/445 of query aligns to 5:436/443 of 6fyqA
- active site: F15 (≠ W28), Y147 (= Y148), D243 (= D253), K272 (= K282)
- binding pyridoxal-5'-phosphate: G114 (= G121), S115 (≠ A122), Y147 (= Y148), H148 (= H149), G149 (= G150), E210 (= E220), D243 (= D253), V245 (= V255), I246 (≠ M256), K272 (= K282)
5lh9D Amine transaminase crystal structure from an uncultivated pseudomonas species in the plp-bound (internal aldimine) form
34% identity, 91% coverage: 37:439/445 of query aligns to 28:447/449 of 5lh9D
- active site: Y148 (= Y148), D255 (= D253), K284 (= K282), T321 (= T314)
- binding pyridoxal-5'-phosphate: G115 (= G121), S116 (≠ A122), Y148 (= Y148), H149 (= H149), G150 (= G150), E222 (= E220), D255 (= D253), V257 (= V255), K284 (= K282)
5lhaA Amine transaminase crystal structure from an uncultivated pseudomonas species in the pmp-bound form
34% identity, 91% coverage: 37:439/445 of query aligns to 26:445/447 of 5lhaA
- active site: Y146 (= Y148), D253 (= D253), K282 (= K282), T319 (= T314)
- binding 4'-deoxy-4'-aminopyridoxal-5'-phosphate: G113 (= G121), S114 (≠ A122), Y146 (= Y148), H147 (= H149), G148 (= G150), E220 (= E220), D253 (= D253), K282 (= K282), Y318 (≠ L313), T319 (= T314)
5kr6B Directed evolution of transaminases by ancestral reconstruction. Using old proteins for new chemistries
34% identity, 93% coverage: 12:426/445 of query aligns to 5:442/460 of 5kr6B
1szkA The structure of gamma-aminobutyrate aminotransferase mutant: e211s (see paper)
35% identity, 91% coverage: 32:437/445 of query aligns to 19:420/425 of 1szkA
- active site: Y137 (= Y148), E205 (= E220), D238 (= D253), Q241 (≠ M256), K267 (= K282), T296 (= T314), R397 (≠ H414)
- binding 4'-deoxy-4'-aminopyridoxal-5'-phosphate: G110 (= G121), S111 (≠ A122), Y137 (= Y148), H138 (= H149), E205 (= E220), D238 (= D253), V240 (= V255), Q241 (≠ M256), K267 (= K282)
Sites not aligning to the query:
1sffA Structure of gamma-aminobutyrate aminotransferase complex with aminooxyacetate (see paper)
35% identity, 91% coverage: 32:437/445 of query aligns to 19:420/425 of 1sffA
- active site: Y137 (= Y148), E205 (= E220), D238 (= D253), Q241 (≠ M256), K267 (= K282), T296 (= T314), R397 (≠ H414)
- binding 4'-deoxy-4'-acetylyamino-pyridoxal-5'-phosphate: Q78 (≠ P90), G110 (= G121), S111 (≠ A122), Y137 (= Y148), H138 (= H149), R140 (≠ N151), E205 (= E220), D238 (= D253), V240 (= V255), Q241 (≠ M256), K267 (= K282), T296 (= T314)
- binding sulfate ion: N152 (= N167), Y393 (≠ E410)
Sites not aligning to the query:
1sf2A Structure of e. Coli gamma-aminobutyrate aminotransferase (see paper)
35% identity, 91% coverage: 32:437/445 of query aligns to 19:420/425 of 1sf2A
- active site: Y137 (= Y148), E205 (= E220), D238 (= D253), Q241 (≠ M256), K267 (= K282), T296 (= T314), R397 (≠ H414)
- binding pyridoxal-5'-phosphate: G110 (= G121), S111 (≠ A122), Y137 (= Y148), H138 (= H149), E205 (= E220), D238 (= D253), V240 (= V255), Q241 (≠ M256), K267 (= K282)
- binding sulfate ion: N152 (= N167), Y393 (≠ E410)
Sites not aligning to the query:
P22256 4-aminobutyrate aminotransferase GabT; 5-aminovalerate transaminase; GABA aminotransferase; GABA-AT; Gamma-amino-N-butyrate transaminase; GABA transaminase; Glutamate:succinic semialdehyde transaminase; L-AIBAT; EC 2.6.1.19; EC 2.6.1.48 from Escherichia coli (strain K12) (see 2 papers)
35% identity, 91% coverage: 32:437/445 of query aligns to 20:421/426 of P22256
- I50 (≠ L62) mutation to Q: 3-fold decrease in catalytic activity and 12-fold decrease in affinity for GABA.
- GS 111:112 (≠ GA 121:122) binding
- E211 (≠ T225) mutation to S: 100-fold decrease in catalytic activity and 15-fold decrease in affinity for GABA.
- V241 (= V255) mutation to A: 25-fold decrease in catalytic activity and 5-fold decrease in affinity for GABA.
- Q242 (≠ M256) binding
- K268 (= K282) modified: N6-(pyridoxal phosphate)lysine
- T297 (= T314) binding
7qzjA 1.55 a x-ray crystallographic structure of saph from streptomyces sp. (Hph0547) involved in pseudouridimycin biosynthesis (see paper)
34% identity, 96% coverage: 12:440/445 of query aligns to 1:422/422 of 7qzjA
- binding 4'-deoxy-4'-aminopyridoxal-5'-phosphate: S109 (≠ A120), G110 (= G121), S111 (≠ A122), Y142 (= Y148), H143 (= H149), G144 (= G150), E209 (= E220), D242 (= D253), V244 (= V255), K271 (= K282), H306 (vs. gap), T307 (vs. gap)
3gjuA Crystal structure of a putative aminotransferase (mll7127) from mesorhizobium loti maff303099 at 1.55 a resolution
30% identity, 96% coverage: 13:438/445 of query aligns to 6:458/458 of 3gjuA
- active site: S21 (≠ W28), Y154 (= Y148), E228 (= E220), D261 (= D253), V264 (≠ M256), K290 (= K282), T327 (= T314), G430 (≠ H414)
- binding pyridoxal-5'-phosphate: S120 (≠ A120), G121 (= G121), S122 (≠ A122), Y154 (= Y148), H155 (= H149), E228 (= E220), D261 (= D253), V263 (= V255), K290 (= K282)
5kquC Directed evolution of transaminases by ancestral reconstruction. Using old proteins for new chemistries
32% identity, 88% coverage: 14:406/445 of query aligns to 5:418/459 of 5kquC
6g4fA Crystal structure of the omega transaminase from pseudomonas jessenii in complex with pmp (see paper)
30% identity, 91% coverage: 20:426/445 of query aligns to 7:431/451 of 6g4fA
- active site: Y15 (≠ W28), Y146 (= Y148), D253 (= D253), K282 (= K282)
- binding 4'-deoxy-4'-aminopyridoxal-5'-phosphate: S112 (≠ A120), G113 (= G121), S114 (≠ A122), Y146 (= Y148), H147 (= H149), E220 (= E220), D253 (= D253), V255 (= V255), I256 (≠ M256), K282 (= K282)
6g4eA Crystal structure of the omega transaminase from pseudomonas jessenii in complex with plp and 6-aminohexanoate (6-aca) (see paper)
30% identity, 91% coverage: 20:426/445 of query aligns to 7:431/451 of 6g4eA
- active site: Y15 (≠ W28), Y146 (= Y148), D253 (= D253), K282 (= K282)
- binding 6-aminohexanoic acid: K282 (= K282), R412 (≠ F407), M414 (≠ V409)
- binding pyridoxal-5'-phosphate: S112 (≠ A120), G113 (= G121), S114 (≠ A122), Y146 (= Y148), H147 (= H149), E220 (= E220), D253 (= D253), V255 (= V255), I256 (≠ M256), K282 (= K282)
6g4dB Crystal structure of the omega transaminase from pseudomonas jessenii in complex with plp (see paper)
30% identity, 91% coverage: 20:426/445 of query aligns to 7:431/453 of 6g4dB
- active site: Y15 (≠ W28), Y146 (= Y148), D253 (= D253), K282 (= K282)
- binding pyridoxal-5'-phosphate: S112 (≠ A120), G113 (= G121), S114 (≠ A122), Y146 (= Y148), H147 (= H149), E220 (= E220), D253 (= D253), V255 (= V255), I256 (≠ M256), K282 (= K282)
3fcrA Crystal structure of putative aminotransferase (yp_614685.1) from silicibacter sp. Tm1040 at 1.80 a resolution
33% identity, 86% coverage: 11:391/445 of query aligns to 3:402/458 of 3fcrA
- active site: S20 (vs. gap), Y153 (= Y148), E227 (= E220), D260 (= D253), V263 (≠ M256), K289 (= K282), T326 (= T314)
- binding pyridoxal-5'-phosphate: G120 (= G121), S121 (≠ A122), Y153 (= Y148), H154 (= H149), E227 (= E220), D260 (= D253), V262 (= V255), K289 (= K282)
Sites not aligning to the query:
Query Sequence
>BWI76_RS07600 BWI76_RS07600 aspartate aminotransferase family protein
MKLALQNEVAISNDEVRQLDRAYVFHSWSMQGNLHPLVIAGAKGCELWDYEGNTYLDFSS
QLVNVNIGYQHPRVLAAMKAQLEALVTIAPATANLARGEAAKRIVELAPEGFSKVFFTNA
GADANENAIRMARLYTGRDKVLSAYRSYHGNTGSAIAATGDWRRVPNEYSRGHVHFFNPY
LYRSEFNATTEEEECQRALAHLRRMIECEGPNAIAAILLESIPGTAGILVPPEGYMQGVR
ALADEFGIILILDEVMAGFGRTGSWFAFEQDGVVPDLVTFAKGVNAGYVPAGGVLISEPI
ARYFDDHFFAGGLTYSGHPLAMAAIVATIDAMKEEKVVENAATIGNEVLRPGLEALAEKH
AIIGNVRGRGLFQALELVSSREHKTPLGAADMAAIKGALTEAGLLAFVVENRIHVVPPCT
ISAEQVAKGLAIFDAVFARFASLAK
Or try a new SitesBLAST search
SitesBLAST's Database
SitesBLAST's database includes
(1) SwissProt
entries with experimentally-supported functional features;
and (2) protein structures with bound ligands, from the
BioLip database.
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory