SitesBLAST
Comparing BWI76_RS07640 BWI76_RS07640 short chain dehydrogenase to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
4urfB Molecular genetic and crystal structural analysis of 1-(4- hydroxyphenyl)-ethanol dehydrogenase from aromatoleum aromaticum ebn1 (see paper)
42% identity, 95% coverage: 13:260/261 of query aligns to 3:247/248 of 4urfB
- active site: G16 (= G26), S142 (= S152), I152 (≠ L162), Y155 (= Y167), K159 (= K171)
- binding 3-pyridinium-1-ylpropane-1-sulfonate: L210 (≠ I223), R211 (≠ Q224), R212 (= R225)
- binding bicarbonate ion: I92 (= I103), G94 (≠ N105), R109 (= R119), R179 (= R191), S228 (= S241)
- binding nicotinamide-adenine-dinucleotide: G12 (= G22), G14 (= G24), N15 (≠ S25), G16 (= G26), I17 (= I27), D36 (= D46), I37 (≠ L47), D62 (= D73), T63 (≠ V74), N89 (≠ A100), A90 (= A101), G91 (= G102), I140 (= I150), Y155 (= Y167), K159 (= K171), P185 (= P197), A186 (≠ G198), I188 (≠ T200), T190 (= T202)
4urfA Molecular genetic and crystal structural analysis of 1-(4- hydroxyphenyl)-ethanol dehydrogenase from aromatoleum aromaticum ebn1 (see paper)
42% identity, 95% coverage: 13:260/261 of query aligns to 3:247/248 of 4urfA
- active site: G16 (= G26), S142 (= S152), I152 (≠ L162), Y155 (= Y167), K159 (= K171)
- binding 3-pyridinium-1-ylpropane-1-sulfonate: I92 (= I103), S93 (≠ A104), G94 (≠ N105), E95 (≠ A106), T97 (≠ N107), E101 (= E111), T103 (≠ E113), Q106 (= Q116), R109 (= R119), S175 (≠ G187), G177 (= G189)
- binding magnesium ion: S237 (≠ V250), Y238 (≠ D251)
- binding nicotinamide-adenine-dinucleotide: G12 (= G22), G14 (= G24), N15 (≠ S25), G16 (= G26), I17 (= I27), D36 (= D46), I37 (≠ L47), W41 (≠ G51), D62 (= D73), T63 (≠ V74), N89 (≠ A100), A90 (= A101), G91 (= G102), I140 (= I150), Y155 (= Y167), K159 (= K171), P185 (= P197), I188 (≠ T200), T190 (= T202)
4ureB Molecular genetic and crystal structural analysis of 1-(4- hydroxyphenyl)-ethanol dehydrogenase from aromatoleum aromaticum ebn1 (see paper)
42% identity, 95% coverage: 13:260/261 of query aligns to 3:247/248 of 4ureB
- active site: G16 (= G26), S142 (= S152), I152 (≠ L162), Y155 (= Y167), K159 (= K171)
- binding 3-pyridinium-1-ylpropane-1-sulfonate: N15 (≠ S25), G16 (= G26), I17 (= I27), N89 (≠ A100), G91 (= G102), Y155 (= Y167), P185 (= P197), A186 (≠ G198)
6ixmC Crystal structure of the ketone reductase chkred20 from the genome of chryseobacterium sp. Ca49 complexed with NAD (see paper)
40% identity, 94% coverage: 13:258/261 of query aligns to 3:245/248 of 6ixmC
- active site: G16 (= G26), S142 (= S152), Y155 (= Y167), K159 (= K171)
- binding nicotinamide-adenine-dinucleotide: G12 (= G22), S15 (= S25), G16 (= G26), I17 (= I27), D36 (= D46), I37 (≠ L47), A61 (≠ G72), D62 (= D73), T63 (≠ V74), N89 (≠ A100), A90 (= A101), M140 (≠ I150), S142 (= S152), Y155 (= Y167), K159 (= K171), P185 (= P197), A186 (≠ G198), Y187 (= Y199), I188 (≠ T200), L192 (≠ M204)
3lqfA Crystal structure of the short-chain dehydrogenase galactitol- dehydrogenase (gatdh) of rhodobacter sphaeroides in complex with NAD and erythritol (see paper)
39% identity, 97% coverage: 8:261/261 of query aligns to 4:254/254 of 3lqfA
- active site: G22 (= G26), S144 (= S152), Y159 (= Y167), K163 (= K171)
- binding meso-erythritol: N151 (= N159), Y159 (= Y167), Y191 (= Y199), T197 (vs. gap), M200 (= M204)
- binding nicotinamide-adenine-dinucleotide: G18 (= G22), S21 (= S25), G22 (= G26), I23 (= I27), D42 (= D46), R43 (= R48), D66 (= D73), V67 (= V74), S92 (≠ A100), L142 (≠ I150), S144 (= S152), K163 (= K171), P189 (= P197), V192 (≠ T200), T194 (= T202), M196 (vs. gap), T197 (vs. gap)
2wsbA Crystal structure of the short-chain dehydrogenase galactitol-dehydrogenase (gatdh) of rhodobacter sphaeroides in complex with NAD (see paper)
39% identity, 97% coverage: 8:261/261 of query aligns to 4:254/254 of 2wsbA
- active site: G22 (= G26), S144 (= S152), Y159 (= Y167), K163 (= K171)
- binding nicotinamide-adenine-dinucleotide: G18 (= G22), S21 (= S25), G22 (= G26), I23 (= I27), D42 (= D46), R43 (= R48), D66 (= D73), V67 (= V74), S92 (≠ A100), A93 (= A101), L142 (≠ I150), S144 (= S152), Y159 (= Y167), K163 (= K171), P189 (= P197), V192 (≠ T200), T194 (= T202), M196 (vs. gap), T197 (vs. gap)
- binding n-propanol: S144 (= S152), M145 (= M153), N151 (= N159), N151 (= N159), Y159 (= Y167), Y159 (= Y167), Y191 (= Y199)
2wdzA Crystal structure of the short chain dehydrogenase galactitol-dehydrogenase (gatdh) of rhodobacter sphaeroides in complex with NAD+ and 1,2-pentandiol (see paper)
39% identity, 97% coverage: 8:261/261 of query aligns to 4:254/254 of 2wdzA
- active site: G22 (= G26), S144 (= S152), Y159 (= Y167), K163 (= K171)
- binding (2S)-pentane-1,2-diol: A45 (≠ D50), D49 (≠ A54), R62 (≠ F69), S146 (= S154), Y159 (= Y167)
- binding nicotinamide-adenine-dinucleotide: G18 (= G22), S21 (= S25), G22 (= G26), I23 (= I27), D42 (= D46), R43 (= R48), A65 (≠ G72), D66 (= D73), V67 (= V74), S92 (≠ A100), A93 (= A101), L142 (≠ I150), S144 (= S152), Y159 (= Y167), K163 (= K171), P189 (= P197), V192 (≠ T200), T194 (= T202), M196 (vs. gap), T197 (vs. gap)
C0KTJ6 Galactitol 2-dehydrogenase (L-tagatose-forming); Galactitol dehydrogenase; GDH; GatDH; Galactitol:NAD(+) 5-oxidoreductase; EC 1.1.1.406 from Cereibacter sphaeroides (Rhodobacter sphaeroides) (see paper)
39% identity, 97% coverage: 8:261/261 of query aligns to 4:254/254 of C0KTJ6
3uf0A Crystal structure of a putative NAD(p) dependent gluconate 5- dehydrogenase from beutenbergia cavernae(efi target efi-502044) with bound NADP (low occupancy)
42% identity, 96% coverage: 11:260/261 of query aligns to 3:248/249 of 3uf0A
- active site: G18 (= G26), S141 (= S152), V151 (≠ Q164), Y154 (= Y167), K158 (= K171)
- binding nadp nicotinamide-adenine-dinucleotide phosphate: G14 (= G22), S17 (= S25), G18 (= G26), I19 (= I27), R39 (= R48), D63 (= D73), L64 (= L77), N89 (≠ A100), G91 (= G102), I92 (= I103), I139 (= I150), A140 (= A151), S141 (= S152), Y154 (= Y167), K158 (= K171), P184 (= P197), G185 (= G198), V187 (≠ T200), T189 (= T202), N191 (= N205), T192 (= T206)
4jroC Crystal structure of 3-oxoacyl-[acyl-carrier protein]reductase (fabg) from listeria monocytogenes in complex with NADP+
40% identity, 95% coverage: 13:259/261 of query aligns to 3:246/247 of 4jroC
- active site: G16 (= G26), S142 (= S152), Q152 (= Q164), Y155 (= Y167), K159 (= K171)
- binding nadp nicotinamide-adenine-dinucleotide phosphate: G12 (= G22), S14 (≠ G24), R15 (≠ S25), G16 (= G26), I17 (= I27), N35 (≠ F45), Y36 (≠ D46), N37 (≠ L47), G38 (≠ R48), S39 (≠ E49), N63 (≠ D73), V64 (= V74), N90 (≠ A100), A91 (= A101), I93 (= I103), I113 (= I123), S142 (= S152), Y155 (= Y167), K159 (= K171), P185 (= P197), I188 (≠ T200), T190 (= T202)
4dmmB 3-oxoacyl-[acyl-carrier-protein] reductase from synechococcus elongatus pcc 7942 in complex with NADP
43% identity, 95% coverage: 13:259/261 of query aligns to 3:238/240 of 4dmmB
- active site: G16 (= G26), S142 (= S152), Q152 (= Q164), Y155 (= Y167), K159 (= K171)
- binding nadp nicotinamide-adenine-dinucleotide phosphate: G12 (= G22), S14 (≠ G24), R15 (≠ S25), G16 (= G26), I17 (= I27), A37 (≠ L47), S38 (≠ R48), S39 (≠ E49), A62 (≠ G72), D63 (= D73), V64 (= V74), N90 (≠ A100), A91 (= A101), L113 (≠ I123), I140 (= I150), S142 (= S152), Y155 (= Y167), K159 (= K171), P185 (= P197), G186 (= G198), I188 (≠ T200), T190 (= T202), M192 (= M204)
4nbuB Crystal structure of fabg from bacillus sp (see paper)
38% identity, 96% coverage: 9:259/261 of query aligns to 1:243/244 of 4nbuB
- active site: G18 (= G26), N111 (= N124), S139 (= S152), Q149 (= Q164), Y152 (= Y167), K156 (= K171)
- binding acetoacetyl-coenzyme a: D93 (≠ A106), K98 (≠ E111), S139 (= S152), N146 (= N159), V147 (≠ R160), Q149 (= Q164), Y152 (= Y167), F184 (≠ Y199), M189 (= M204), K200 (≠ E216)
- binding 1,4-dihydronicotinamide adenine dinucleotide: G14 (= G22), N17 (≠ S25), G18 (= G26), I19 (= I27), D38 (= D46), F39 (≠ L47), V59 (≠ G72), D60 (= D73), V61 (= V74), N87 (≠ A100), A88 (= A101), G89 (= G102), I90 (= I103), T137 (≠ I150), S139 (= S152), Y152 (= Y167), K156 (= K171), P182 (= P197), F184 (≠ Y199), T185 (= T200), T187 (= T202), M189 (= M204)
1edoA The x-ray structure of beta-keto acyl carrier protein reductase from brassica napus complexed with NADP+ (see paper)
40% identity, 93% coverage: 17:258/261 of query aligns to 3:242/244 of 1edoA
- active site: G12 (= G26), S138 (= S152), Y151 (= Y167), K155 (= K171)
- binding nadp nicotinamide-adenine-dinucleotide phosphate: G8 (= G22), S10 (≠ G24), R11 (≠ S25), I13 (= I27), N31 (≠ F45), Y32 (≠ D46), A33 (≠ L47), R34 (= R48), S35 (≠ E49), D59 (= D73), V60 (= V74), N86 (≠ A100), A87 (= A101), S138 (= S152), Y151 (= Y167), K155 (= K171), P181 (= P197), G182 (= G198), I184 (≠ T200), S186 (≠ T202), M188 (= M204)
P73574 3-oxoacyl-[acyl-carrier-protein] reductase; 3-ketoacyl-acyl carrier protein reductase; EC 1.1.1.100 from Synechocystis sp. (strain PCC 6803 / Kazusa) (see paper)
39% identity, 95% coverage: 13:261/261 of query aligns to 4:247/247 of P73574
- A14 (= A23) mutation to G: 4.2-fold increase in activity on acetoacetyl-CoA.
- P151 (≠ R160) mutation to F: 2.7-fold increase in activity on acetoacetyl-CoA.; mutation to V: 5.7-fold increase in activity on acetoacetyl-CoA.
- K160 (= K171) mutation to A: Almost no activity on acetoacetyl-CoA.
- F188 (≠ Y199) mutation to Y: 3.3-fold increase in activity on acetoacetyl-CoA.
- N198 (≠ R207) mutation to R: 3.5-fold increase in activity on acetoacetyl-CoA.
4nbtA Crystal structure of fabg from acholeplasma laidlawii (see paper)
39% identity, 94% coverage: 13:258/261 of query aligns to 3:237/239 of 4nbtA
- active site: G16 (= G26), S132 (= S152), Y145 (= Y167), K149 (= K171)
- binding nicotinamide-adenine-dinucleotide: G12 (= G22), K15 (≠ S25), G16 (= G26), L17 (≠ I27), D36 (= D46), L37 (= L47), L52 (≠ F69), N53 (≠ Y70), V54 (≠ T71), N80 (≠ A100), A81 (= A101), G82 (= G102), I130 (= I150), S132 (= S152), Y145 (= Y167), K149 (= K171), P177 (= P197), G178 (= G198), I180 (≠ T200), T182 (= T202)
1vl8B Crystal structure of gluconate 5-dehydrogenase (tm0441) from thermotoga maritima at 2.07 a resolution
37% identity, 95% coverage: 10:258/261 of query aligns to 1:249/252 of 1vl8B
- active site: G17 (= G26), S143 (= S152), I154 (≠ Q164), Y157 (= Y167), K161 (= K171)
- binding nadp nicotinamide-adenine-dinucleotide phosphate: G13 (= G22), R16 (≠ S25), G17 (= G26), L18 (≠ I27), S37 (≠ D46), R38 (≠ L47), C63 (≠ G72), D64 (= D73), V65 (= V74), A91 (= A100), A92 (= A101), G93 (= G102), I94 (= I103), V114 (≠ I123), I141 (= I150), S143 (= S152), Y157 (= Y167), K161 (= K171), P187 (= P197), G188 (= G198), Y190 (≠ T200), T192 (= T202), M194 (= M204), T195 (≠ N205)
3ay6B Crystal structure of bacillus megaterium glucose dehydrogenase 4 a258f mutant in complex with nadh and d-glucose (see paper)
35% identity, 96% coverage: 12:261/261 of query aligns to 10:259/267 of 3ay6B
- active site: G24 (= G26), S151 (= S152), Y164 (= Y167), K168 (= K171)
- binding beta-D-glucopyranose: E102 (≠ A104), S151 (= S152), H153 (≠ S154), W158 (≠ N159), Y164 (= Y167), N202 (= N205), K205 (≠ P208)
- binding 1,4-dihydronicotinamide adenine dinucleotide: G20 (= G22), T23 (≠ S25), G24 (= G26), L25 (≠ I27), Y45 (≠ L47), D71 (= D73), V72 (= V74), N98 (≠ A100), A99 (= A101), G100 (= G102), V101 (≠ I103), M149 (≠ I150), S151 (= S152), Y164 (= Y167), K168 (= K171), P194 (= P197), G195 (= G198), M197 (≠ T200), T199 (= T202), P200 (= P203), I201 (≠ M204), N202 (= N205)
2d1yA Crystal structure of tt0321 from thermus thermophilus hb8 (see paper)
38% identity, 93% coverage: 19:260/261 of query aligns to 9:238/240 of 2d1yA
- active site: G16 (= G26), S135 (= S152), N145 (≠ Q164), Y148 (= Y167), K152 (= K171)
- binding nicotinamide-adenine-dinucleotide: G12 (= G22), R15 (≠ S25), I17 (= I27), D36 (= D46), L37 (= L47), R38 (= R48), V55 (≠ G72), D56 (= D73), L57 (≠ V74), N83 (≠ A100), A84 (= A101), A85 (≠ G102), I86 (= I103), V133 (≠ I150), S135 (= S152), Y148 (= Y167), K152 (= K171), P178 (= P197), G179 (= G198), I181 (≠ T200), T183 (= T202), A185 (≠ M210), V186 (= V211)
1g6kA Crystal structure of glucose dehydrogenase mutant e96a complexed with NAD+
35% identity, 96% coverage: 12:261/261 of query aligns to 4:253/261 of 1g6kA
- active site: G18 (= G26), S145 (= S152), Y158 (= Y167), K162 (= K171)
- binding nicotinamide-adenine-dinucleotide: T17 (≠ S25), G18 (= G26), L19 (≠ I27), R39 (≠ L47), D65 (= D73), V66 (= V74), N92 (≠ A100), A93 (= A101), G94 (= G102), M143 (≠ I150), S145 (= S152), Y158 (= Y167), P188 (= P197), G189 (= G198), I191 (≠ T200), T193 (= T202)
5jc8D Crystal structure of a putative short-chain dehydrogenase/reductase from burkholderia xenovorans
37% identity, 94% coverage: 13:258/261 of query aligns to 4:257/262 of 5jc8D
Query Sequence
>BWI76_RS07640 BWI76_RS07640 short chain dehydrogenase
MIAKDFAQQLFNLQDRVAFVTGAGSGIGQMIAYGLASAGARVVCFDLREDGGLAETVKNI
EAIGGEACFYTGDVRQLSDLRAGVALAKSRFGRLDIAVNAAGIANANPALEMETEQWQRV
IDINLTGVWNSCKAEAELMQETGGGSIINIASMSGIIVNRGLDQAHYNCSKAGVIHLSKS
LAMEWIGKGIRVNSISPGYTATPMNTRPEMVHQTREFESQTPIQRMAKVEEMAGPALFLA
SDAASFCTGVDLVVDGGFVCW
Or try a new SitesBLAST search
SitesBLAST's Database
SitesBLAST's database includes
(1) SwissProt
entries with experimentally-supported functional features;
and (2) protein structures with bound ligands, from the
BioLip database.
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory