SitesBLAST
Comparing BWI76_RS07645 FitnessBrowser__Koxy:BWI76_RS07645 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
3osuA Crystal structure of the 3-oxoacyl-acyl carrier protein reductase, fabg, from staphylococcus aureus
38% identity, 97% coverage: 8:264/265 of query aligns to 5:246/246 of 3osuA
3sj7A Structure of beta-ketoacetyl-coa reductase (fabg) from staphylococcus aureus complex with NADPH (see paper)
37% identity, 97% coverage: 8:264/265 of query aligns to 2:239/239 of 3sj7A
- active site: G12 (= G18), S138 (= S143), Q148 (≠ T153), Y151 (= Y156), K155 (= K160)
- binding nadph dihydro-nicotinamide-adenine-dinucleotide phosphate: G8 (= G14), S10 (≠ C16), R11 (= R17), I13 (= I19), N31 (= N39), Y32 (≠ A40), A33 (≠ E41), G34 (≠ R42), S35 (≠ V43), A58 (≠ V63), N59 (≠ D64), V60 (= V65), N86 (= N91), A87 (= A92), T109 (≠ V114), S138 (= S143), Y151 (= Y156), K155 (= K160), P181 (= P186), G182 (= G187)
4jroC Crystal structure of 3-oxoacyl-[acyl-carrier protein]reductase (fabg) from listeria monocytogenes in complex with NADP+
36% identity, 97% coverage: 8:264/265 of query aligns to 6:247/247 of 4jroC
- active site: G16 (= G18), S142 (= S143), Q152 (≠ T153), Y155 (= Y156), K159 (= K160)
- binding nadp nicotinamide-adenine-dinucleotide phosphate: G12 (= G14), S14 (≠ C16), R15 (= R17), G16 (= G18), I17 (= I19), N35 (≠ V37), Y36 (≠ S38), N37 (= N39), G38 (≠ A40), S39 (vs. gap), N63 (≠ D64), V64 (= V65), N90 (= N91), A91 (= A92), I93 (≠ V94), I113 (≠ V114), S142 (= S143), Y155 (= Y156), K159 (= K160), P185 (= P186), I188 (= I189), T190 (≠ S191)
7tzpG Crystal structure of putataive short-chain dehydrogenase/reductase (fabg) from klebsiella pneumoniae subsp. Pneumoniae ntuh-k2044 in complex with nadh (see paper)
36% identity, 98% coverage: 5:264/265 of query aligns to 6:247/247 of 7tzpG
- binding 1,4-dihydronicotinamide adenine dinucleotide: G15 (= G14), R18 (= R17), G19 (= G18), I20 (= I19), D39 (≠ S38), R40 (≠ N39), C63 (≠ V63), I65 (≠ V65), N91 (= N91), G93 (= G93), I94 (≠ V94), V114 (= V114), Y155 (= Y156), K159 (= K160), I188 (= I189), T190 (≠ S191), T193 (≠ W194)
4nbuB Crystal structure of fabg from bacillus sp (see paper)
36% identity, 97% coverage: 8:264/265 of query aligns to 8:244/244 of 4nbuB
- active site: G18 (= G18), N111 (= N115), S139 (= S143), Q149 (≠ T153), Y152 (= Y156), K156 (= K160)
- binding acetoacetyl-coenzyme a: D93 (≠ I97), K98 (≠ R102), S139 (= S143), N146 (≠ F150), V147 (≠ I151), Q149 (≠ T153), Y152 (= Y156), F184 (≠ I188), M189 (= M193), K200 (≠ E220)
- binding 1,4-dihydronicotinamide adenine dinucleotide: G14 (= G14), N17 (≠ R17), G18 (= G18), I19 (= I19), D38 (≠ S38), F39 (≠ V43), V59 (= V63), D60 (= D64), V61 (= V65), N87 (= N91), A88 (= A92), G89 (= G93), I90 (≠ V94), T137 (= T141), S139 (= S143), Y152 (= Y156), K156 (= K160), P182 (= P186), F184 (≠ I188), T185 (≠ I189), T187 (≠ S191), M189 (= M193)
1edoA The x-ray structure of beta-keto acyl carrier protein reductase from brassica napus complexed with NADP+ (see paper)
39% identity, 95% coverage: 10:262/265 of query aligns to 4:242/244 of 1edoA
- active site: G12 (= G18), S138 (= S143), Y151 (= Y156), K155 (= K160)
- binding nadp nicotinamide-adenine-dinucleotide phosphate: G8 (= G14), S10 (≠ C16), R11 (= R17), I13 (= I19), N31 (= N39), Y32 (≠ A40), A33 (≠ E41), R34 (= R42), S35 (≠ V43), D59 (= D64), V60 (= V65), N86 (= N91), A87 (= A92), S138 (= S143), Y151 (= Y156), K155 (= K160), P181 (= P186), G182 (= G187), I184 (= I189), S186 (= S191), M188 (= M193)
4dmmB 3-oxoacyl-[acyl-carrier-protein] reductase from synechococcus elongatus pcc 7942 in complex with NADP
37% identity, 98% coverage: 5:265/265 of query aligns to 3:240/240 of 4dmmB
- active site: G16 (= G18), S142 (= S143), Q152 (≠ T153), Y155 (= Y156), K159 (= K160)
- binding nadp nicotinamide-adenine-dinucleotide phosphate: G12 (= G14), S14 (≠ C16), R15 (= R17), G16 (= G18), I17 (= I19), A37 (≠ S38), S38 (≠ N39), S39 (≠ A40), A62 (≠ V63), D63 (= D64), V64 (= V65), N90 (= N91), A91 (= A92), L113 (≠ V114), I140 (≠ T141), S142 (= S143), Y155 (= Y156), K159 (= K160), P185 (= P186), G186 (= G187), I188 (= I189), T190 (≠ S191), M192 (= M218)
5itvA Crystal structure of bacillus subtilis bacc dihydroanticapsin 7- dehydrogenase in complex with nadh (see paper)
37% identity, 98% coverage: 1:261/265 of query aligns to 1:251/255 of 5itvA
- active site: G18 (= G18), S141 (= S143), Y154 (= Y156), K158 (= K160)
- binding 1,4-dihydronicotinamide adenine dinucleotide: G14 (= G14), S17 (≠ R17), G18 (= G18), I19 (= I19), D38 (≠ S38), I39 (≠ N39), T61 (≠ V63), I63 (≠ V65), N89 (= N91), G91 (= G93), T139 (= T141), S141 (= S143), Y154 (= Y156), K158 (= K160), P184 (= P186), G185 (= G187), I186 (= I188), I187 (= I189)
6t77A Crystal structure of klebsiella pneumoniae fabg(NADPH-dependent) NADP- complex at 1.75 a resolution (see paper)
34% identity, 98% coverage: 4:264/265 of query aligns to 2:243/244 of 6t77A
- active site: G16 (= G18), S138 (= S143), Y151 (= Y156)
- binding nadp nicotinamide-adenine-dinucleotide phosphate: G12 (= G14), S14 (≠ C16), R15 (= R17), T37 (≠ N39), L58 (≠ V63), N59 (≠ D64), V60 (= V65), A87 (= A92), G88 (= G93), I89 (≠ V94)
P0AEK2 3-oxoacyl-[acyl-carrier-protein] reductase FabG; 3-ketoacyl-acyl carrier protein reductase; Beta-Ketoacyl-acyl carrier protein reductase; Beta-ketoacyl-ACP reductase; EC 1.1.1.100 from Escherichia coli (strain K12) (see 2 papers)
34% identity, 98% coverage: 4:264/265 of query aligns to 2:243/244 of P0AEK2
- GASR 12:15 (≠ GACR 14:17) binding
- T37 (≠ N39) binding
- NV 59:60 (≠ DV 64:65) binding
- N86 (= N91) binding
- Y151 (= Y156) mutation to F: Defect in the affinity for NADPH.
- YAAAK 151:155 (≠ YAASK 156:160) binding
- A154 (≠ S159) mutation to T: Decreases in the thermolability of the reductase; when associated with K-233.
- K155 (= K160) mutation to A: Defect in the affinity for NADPH.
- I184 (= I189) binding
- E233 (≠ Q254) mutation to K: Decreases in the thermolability of the reductase; when associated with T-154.
1q7bA The structure of betaketoacyl-[acp] reductase from e. Coli in complex with NADP+ (see paper)
34% identity, 98% coverage: 4:264/265 of query aligns to 1:242/243 of 1q7bA
- active site: G15 (= G18), E101 (≠ D107), S137 (= S143), Q147 (≠ T153), Y150 (= Y156), K154 (= K160)
- binding calcium ion: E232 (≠ Q254), T233 (= T255)
- binding nadp nicotinamide-adenine-dinucleotide phosphate: G11 (= G14), S13 (≠ C16), R14 (= R17), T36 (≠ N39), N58 (≠ D64), V59 (= V65), N85 (= N91), A86 (= A92), G87 (= G93), I88 (≠ V94), S137 (= S143), Y150 (= Y156), K154 (= K160), P180 (= P186), G181 (= G187), I183 (= I189)
3wyeA Crystal structure of chimeric engineered (2s,3s)-butanediol dehydrogenase complexed with NAD+
35% identity, 98% coverage: 7:265/265 of query aligns to 1:255/255 of 3wyeA
- active site: G12 (= G18), S138 (= S143), Y151 (= Y156), K155 (= K160), L196 (≠ E208)
- binding nicotinamide-adenine-dinucleotide: G8 (= G14), Q11 (≠ R17), G12 (= G18), I13 (= I19), D32 (≠ S38), Y33 (≠ N39), V57 (= V63), D58 (= D64), V59 (= V65), N85 (= N91), A86 (= A92), S138 (= S143), Y151 (= Y156), K155 (= K160), P181 (= P186), G182 (= G187), V184 (≠ I189), T186 (≠ S191), M188 (= M193), W189 (= W194)
1q7cA The structure of betaketoacyl-[acp] reductase y151f mutant in complex with NADPH fragment (see paper)
34% identity, 98% coverage: 4:264/265 of query aligns to 1:242/243 of 1q7cA
- active site: G15 (= G18), S137 (= S143), Q147 (≠ T153), F150 (≠ Y156), K154 (= K160)
- binding nadph dihydro-nicotinamide-adenine-dinucleotide phosphate: G11 (= G14), S13 (≠ C16), R14 (= R17), A35 (≠ S38), T36 (≠ N39), L57 (≠ V63), N58 (≠ D64), V59 (= V65), G87 (= G93), I88 (≠ V94)
3a28C Crystal structure of l-2,3-butanediol dehydrogenase (see paper)
35% identity, 97% coverage: 7:263/265 of query aligns to 1:255/257 of 3a28C
- active site: G12 (= G18), S140 (= S143), Y153 (= Y156), K157 (= K160), L198 (≠ W201)
- binding nicotinamide-adenine-dinucleotide: G8 (= G14), Q11 (≠ R17), I13 (= I19), D32 (≠ S38), L33 (≠ N39), Q36 (≠ R42), L59 (vs. gap), D60 (= D64), V61 (= V65), N87 (= N91), S140 (= S143), Y153 (= Y156), K157 (= K160), P183 (= P186), V186 (≠ I189), T188 (≠ S191), M190 (= M193), W191 (= W194)
4qecA Elxo with NADP bound (see paper)
34% identity, 97% coverage: 8:263/265 of query aligns to 3:246/248 of 4qecA
- active site: G13 (= G18), N111 (= N115), S139 (= S143), Y152 (= Y156), K156 (= K160)
- binding nadp nicotinamide-adenine-dinucleotide phosphate: K12 (≠ R17), G13 (= G18), I14 (= I19), S33 (= S38), R34 (≠ N39), K38 (≠ V43), D59 (= D64), V60 (= V65), N86 (= N91), A87 (= A92), G88 (= G93), I137 (≠ T141), Y152 (= Y156), K156 (= K160), P182 (= P186), I185 (= I189)
Q9ZNN8 L-2,3-butanediol dehydrogenase; L-BDH; (S,S)-butanediol dehydrogenase; Diacetyl reductase [(S)-acetoin forming]; EC 1.1.1.76; EC 1.1.1.304 from Corynebacterium glutamicum (Brevibacterium saccharolyticum) (see paper)
35% identity, 97% coverage: 7:263/265 of query aligns to 2:256/258 of Q9ZNN8
- QGI 12:14 (≠ RGI 17:19) binding
- D33 (≠ S38) binding
- Q37 (≠ R42) binding
- DV 61:62 (= DV 64:65) binding
- N88 (= N91) binding
- I142 (≠ G144) mutation to Q: Loss of L-BD oxidizing activity, and does not gain the ability to use meso-BD as substrate; when associated with N-148.; mutation to Q: Loss of L-BD oxidizing activity. Does not gain the ability to use meso-BD as substrate.
- F148 (= F150) mutation to N: Loss of L-BD oxidizing activity, and does not gain the ability to use meso-BD as substrate; when associated with Q-142.; mutation to N: Loss of L-BD oxidizing activity. Does not gain the ability to use meso-BD as substrate.
- Y154 (= Y156) binding
- K158 (= K160) binding
- PGIVGT 184:189 (≠ PGIIES 186:191) binding
1gegE Cryatal structure analysis of meso-2,3-butanediol dehydrogenase (see paper)
35% identity, 97% coverage: 8:265/265 of query aligns to 3:256/256 of 1gegE
- active site: G13 (= G18), S139 (= S143), Y152 (= Y156), K156 (= K160), V197 (≠ I204)
- binding alpha-D-glucopyranose: R63 (≠ E68), D64 (≠ A69), F67 (≠ Q72), E123 (≠ K128)
- binding nicotinamide-adenine-dinucleotide: G9 (= G14), Q12 (≠ R17), I14 (= I19), D33 (≠ S38), Y34 (≠ N39), V58 (= V63), D59 (= D64), V60 (= V65), N86 (= N91), A87 (= A92), I109 (≠ V114), S139 (= S143), Y152 (= Y156), K156 (= K160), P182 (= P186), V185 (≠ I189), T187 (≠ S191), M189 (= M193)
Q48436 Diacetyl reductase [(S)-acetoin forming]; Acetoin(diacetyl) reductase; AR; Meso-2,3-butanediol dehydrogenase; EC 1.1.1.304 from Klebsiella pneumoniae (see paper)
35% identity, 98% coverage: 7:265/265 of query aligns to 2:256/256 of Q48436
- 6:33 (vs. 11:38, 39% identical) binding
- D59 (= D64) binding
- K156 (= K160) binding
5ovlA Crystal structure of maba bound to NADP+ from m. Smegmatis (see paper)
34% identity, 98% coverage: 5:264/265 of query aligns to 7:239/241 of 5ovlA
- active site: G20 (= G18), S134 (= S143), Y147 (= Y156), L154 (≠ V163)
- binding nadp nicotinamide-adenine-dinucleotide phosphate: G16 (= G14), N18 (≠ C16), R19 (= R17), G20 (= G18), I21 (= I19), R41 (= R51), D55 (= D64), V56 (= V65), N82 (= N91), A83 (= A92), I85 (≠ V94), T105 (≠ V114), I132 (≠ T141), S134 (= S143), Y147 (= Y156), K151 (= K160), P177 (= P186), G178 (= G187), I180 (= I189)
5ovkA Crystal structure maba bound to NADPH from m. Smegmatis (see paper)
34% identity, 98% coverage: 5:264/265 of query aligns to 8:240/242 of 5ovkA
Query Sequence
>BWI76_RS07645 FitnessBrowser__Koxy:BWI76_RS07645
MQRNFTHKTVVITGACRGIGAGIAERFARDGANLVMVSNAERVHETAETLRQRYQADILS
LQVDVTDEAQVQSLYEQAAARFGAIDVSIQNAGVITIDYYDRMPKADFEKVLAVNTTGVW
LCCREAAKYMVKQNHGSLINTSSGQGRQGFIYTPHYAASKMGVIGITQSLAHELAPWNIT
VNAFCPGIIESEMWDYNDRVWGEILSTEQKRYGKGELMAEWVEGIPMKRAGKPEDVAGLV
AFLASDDARYLTGQTINIDGGLIMS
Or try a new SitesBLAST search
SitesBLAST's Database
SitesBLAST's database includes
(1) SwissProt
entries with experimentally-supported functional features;
and (2) protein structures with bound ligands, from the
BioLip database.
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory