Comparing BWI76_RS07665 FitnessBrowser__Koxy:BWI76_RS07665 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
5ibqA Crystal structure of an abc solute binding protein from rhizobium etli cfn 42 (rhe_pf00037,target efi-511357) in complex with alpha-d-apiose
49% identity, 90% coverage: 28:307/311 of query aligns to 5:284/287 of 5ibqA
4ry0A Crystal structure of ribose transporter solute binding protein rhe_pf00037 from rhizobium etli cfn 42, target efi-511357, in complex with d-ribose
49% identity, 90% coverage: 28:307/311 of query aligns to 5:284/287 of 4ry0A
2fn8A Thermotoga maritima ribose binding protein ribose bound form (see paper)
35% identity, 92% coverage: 25:310/311 of query aligns to 1:292/292 of 2fn8A
2ioyA Crystal structure of thermoanaerobacter tengcongensis ribose binding protein (see paper)
35% identity, 88% coverage: 27:300/311 of query aligns to 2:272/274 of 2ioyA
1dbpA Identical mutations at corresponding positions in two homologous proteins with non-identical effects (see paper)
34% identity, 83% coverage: 25:283/311 of query aligns to 1:256/271 of 1dbpA
7e7mC Crystal structure analysis of the streptococcus agalactiae ribose binding protein rbsb
30% identity, 88% coverage: 30:303/311 of query aligns to 13:281/284 of 7e7mC
4zjpA Structure of an abc-transporter solute binding protein (sbp_ipr025997) from actinobacillus succinogenes (asuc_0197, target efi-511067) with bound beta-d-ribopyranose
32% identity, 83% coverage: 27:283/311 of query aligns to 4:256/270 of 4zjpA
A0QYB5 D-threitol-binding protein from Mycolicibacterium smegmatis (strain ATCC 700084 / mc(2)155) (Mycobacterium smegmatis) (see paper)
30% identity, 97% coverage: 1:302/311 of query aligns to 1:308/349 of A0QYB5
4rsmA Crystal structure of carbohydrate transporter msmeg_3599 from mycobacterium smegmatis str. Mc2 155, target efi-510970, in complex with d-threitol (see paper)
33% identity, 76% coverage: 66:302/311 of query aligns to 42:276/315 of 4rsmA
Sites not aligning to the query:
5dteB Crystal structure of an abc transporter periplasmic solute binding protein (ipr025997) from actinobacillus succinogenes 130z(asuc_0081, target efi-511065) with bound d-allose
30% identity, 76% coverage: 24:259/311 of query aligns to 1:244/287 of 5dteB
Sites not aligning to the query:
A0QYB3 Xylitol-binding protein from Mycolicibacterium smegmatis (strain ATCC 700084 / mc(2)155) (Mycobacterium smegmatis) (see paper)
29% identity, 93% coverage: 14:302/311 of query aligns to 21:308/349 of A0QYB3
4wutA Crystal structure of an abc transporter solute binding protein (ipr025997) from agrobacterium vitis (avi_5133, target efi-511220) with bound d-fucose
27% identity, 91% coverage: 26:309/311 of query aligns to 1:288/290 of 4wutA
5ocpA The periplasmic binding protein component of the arabinose abc transporter from shewanella sp. Ana-3 bound to alpha and beta-l- arabinofuranose
29% identity, 75% coverage: 68:301/311 of query aligns to 41:281/302 of 5ocpA
Sites not aligning to the query:
4rs3A Crystal structure of carbohydrate transporter a0qyb3 from mycobacterium smegmatis str. Mc2 155, target efi-510969, in complex with xylitol (see paper)
28% identity, 89% coverage: 27:302/311 of query aligns to 1:275/315 of 4rs3A
5hkoA Crystal structure of abc transporter solute binding protein msmeg_3598 from mycobacterium smegmatis str. Mc2 155, target efi-510969, in complex with l-sorbitol
28% identity, 89% coverage: 27:302/311 of query aligns to 1:275/314 of 5hkoA
2x7xA Fructose binding periplasmic domain of hybrid two component system bt1754 (see paper)
30% identity, 60% coverage: 55:241/311 of query aligns to 31:217/301 of 2x7xA
Sites not aligning to the query:
2h3hA Crystal structure of the liganded form of thermotoga maritima glucose binding protein (see paper)
30% identity, 72% coverage: 37:259/311 of query aligns to 12:234/313 of 2h3hA
Sites not aligning to the query:
4yo7A Crystal structure of an abc transporter solute binding protein (ipr025997) from bacillus halodurans c-125 (bh2323, target efi- 511484) with bound myo-inositol
27% identity, 77% coverage: 66:305/311 of query aligns to 47:284/287 of 4yo7A
Sites not aligning to the query:
1rpjA Crystal structure of d-allose binding protein from escherichia coli (see paper)
27% identity, 86% coverage: 30:298/311 of query aligns to 6:288/288 of 1rpjA
1gudA Hinge-bending motion of d-allose binding protein from escherichia coli: three open conformations (see paper)
27% identity, 86% coverage: 30:298/311 of query aligns to 6:288/288 of 1gudA
Sites not aligning to the query:
>BWI76_RS07665 FitnessBrowser__Koxy:BWI76_RS07665
MKLRLTLLTAATLTAFSFAAQAAEKGTIMIMVNSLDNPYYASEAKGASEKAKELGYQTTI
LSHGEDVKKQNELIDTAIGKKVQGIILDNADSTASVAAIEKAKKAGIPVVLINREIPVDD
IALEQITHNNFQAGSEVANVFVEKMAEKGKYAELTCNLADNNCVTRSKSFHQVIDQYPDM
VSVAKQDAKGTLIDGKRIMDSILQAHPDVKGVICGNGPVALGAIAALKAANRNDVVVVGI
DGSNDERDAVKAGTLQATVMLQAQAIAAQGVTDLDNYLQKGEKPAKQRVMFRGILITQDN
ADKVQDFNIKS
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory