Comparing BWI76_RS07720 FitnessBrowser__Koxy:BWI76_RS07720 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
P07821 Iron(3+)-hydroxamate import ATP-binding protein FhuC; Ferric hydroxamate uptake protein C; Ferrichrome transport ATP-binding protein FhuC; Iron(III)-hydroxamate import ATP-binding protein FhuC; EC 7.2.2.16 from Escherichia coli (strain K12) (see 2 papers)
45% identity, 90% coverage: 20:257/264 of query aligns to 24:261/265 of P07821
4u00A Crystal structure of ttha1159 in complex with adp (see paper)
35% identity, 82% coverage: 17:233/264 of query aligns to 12:225/241 of 4u00A
4ymuJ Crystal structure of an amino acid abc transporter complex with arginines and atps (see paper)
31% identity, 81% coverage: 17:231/264 of query aligns to 11:223/240 of 4ymuJ
1f3oA Crystal structure of mj0796 atp-binding cassette (see paper)
33% identity, 77% coverage: 24:225/264 of query aligns to 22:226/232 of 1f3oA
Sites not aligning to the query:
Q5M243 Energy-coupling factor transporter ATP-binding protein EcfA1; ECF transporter A component EcfA1; EC 7.-.-.- from Streptococcus thermophilus (strain ATCC BAA-250 / LMG 18311) (see paper)
28% identity, 86% coverage: 12:238/264 of query aligns to 6:233/276 of Q5M243
1l2tA Dimeric structure of mj0796, a bacterial abc transporter cassette (see paper)
33% identity, 77% coverage: 24:225/264 of query aligns to 22:226/230 of 1l2tA
Sites not aligning to the query:
Q5M244 Energy-coupling factor transporter ATP-binding protein EcfA2; ECF transporter A component EcfA2; EC 3.6.3.- from Streptococcus thermophilus (strain ATCC BAA-250 / LMG 18311) (see paper)
35% identity, 83% coverage: 26:243/264 of query aligns to 26:246/280 of Q5M244
3c4jA Abc protein artp in complex with atp-gamma-s
31% identity, 84% coverage: 12:233/264 of query aligns to 8:227/242 of 3c4jA
3c41J Abc protein artp in complex with amp-pnp/mg2+
31% identity, 84% coverage: 12:233/264 of query aligns to 8:227/242 of 3c41J
2olkA Abc protein artp in complex with adp-beta-s
31% identity, 84% coverage: 12:233/264 of query aligns to 8:227/242 of 2olkA
2oljA Abc protein artp in complex with adp/mg2+
31% identity, 84% coverage: 12:233/264 of query aligns to 8:227/242 of 2oljA
7chaI Cryo-em structure of p.Aeruginosa mlafebd with amppnp (see paper)
31% identity, 82% coverage: 13:228/264 of query aligns to 9:224/262 of 7chaI
5x40A Structure of a cbio dimer bound with amppcp (see paper)
34% identity, 94% coverage: 4:250/264 of query aligns to 1:246/280 of 5x40A
P0AAH0 Phosphate import ATP-binding protein PstB; ABC phosphate transporter; Phosphate-transporting ATPase; EC 7.3.2.1 from Escherichia coli (strain K12) (see paper)
33% identity, 83% coverage: 6:223/264 of query aligns to 9:231/257 of P0AAH0
Sites not aligning to the query:
7mdyC Lolcde nucleotide-bound
35% identity, 77% coverage: 22:225/264 of query aligns to 21:223/226 of 7mdyC
Sites not aligning to the query:
P75957 Lipoprotein-releasing system ATP-binding protein LolD; EC 7.6.2.- from Escherichia coli (strain K12) (see paper)
35% identity, 77% coverage: 22:225/264 of query aligns to 24:226/233 of P75957
P69874 Spermidine/putrescine import ATP-binding protein PotA; EC 7.6.2.11 from Escherichia coli (strain K12) (see 3 papers)
30% identity, 89% coverage: 16:249/264 of query aligns to 26:260/378 of P69874
Sites not aligning to the query:
7v8iD Lolcd(e171q)e with bound amppnp in nanodiscs (see paper)
34% identity, 77% coverage: 22:225/264 of query aligns to 23:225/229 of 7v8iD
7arlD Lolcde in complex with lipoprotein and adp (see paper)
34% identity, 77% coverage: 22:224/264 of query aligns to 21:222/222 of 7arlD
P19566 Maltose/maltodextrin import ATP-binding protein MalK; EC 7.5.2.1 from Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) (see paper)
29% identity, 83% coverage: 12:231/264 of query aligns to 8:221/369 of P19566
Sites not aligning to the query:
>BWI76_RS07720 FitnessBrowser__Koxy:BWI76_RS07720
MTAVTSRLRGDQLTLAYGKKTIAESLNVTIPDGHFTAIIGPNGCGKSTLLRTLSRLMTPA
SGHVYLDGEQIQRYASKEVAKRIGLLAQNATTPGDITVQELVARGRYPHQPLFTRWRKED
EEAVSRAMKATGITDLARQSVDTLSGGQRQRAWIAMVLAQETAIMLLDEPTTWLDISHQI
DLLELLSELNQQKGYTLAAVLHDLNQACRYATHLIALREGKIVAEGAPKEIVSAELIEKI
YGLRCTIIEDPVAHTPLVVPLGRR
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory