Comparing BWI76_RS07840 FitnessBrowser__Koxy:BWI76_RS07840 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
P0ADG4 Nus factor SuhB; Inositol-1-monophosphatase; I-1-Pase; IMPase; Inositol-1-phosphatase; EC 3.1.3.25 from Escherichia coli (strain K12) (see 5 papers)
32% identity, 94% coverage: 15:268/269 of query aligns to 7:265/267 of P0ADG4
6ib8B Structure of a complex of suhb and nusa ar2 domain (see paper)
32% identity, 94% coverage: 15:268/269 of query aligns to 11:269/270 of 6ib8B
2qflA Structure of suhb: inositol monophosphatase and extragenic suppressor from e. Coli (see paper)
32% identity, 93% coverage: 15:265/269 of query aligns to 7:262/262 of 2qflA
6tqoT Rrn anti-termination complex (see paper)
33% identity, 85% coverage: 37:265/269 of query aligns to 19:254/255 of 6tqoT
3lv0A Crystal structure of extragenic suppressor protein suhb from bartonella henselae, native
32% identity, 91% coverage: 21:264/269 of query aligns to 13:254/258 of 3lv0A
3luzA Crystal structure of extragenic suppressor protein suhb from bartonella henselae, via combined iodide sad molecular replacement (see paper)
31% identity, 81% coverage: 47:264/269 of query aligns to 24:236/238 of 3luzA
Sites not aligning to the query:
3luzB Crystal structure of extragenic suppressor protein suhb from bartonella henselae, via combined iodide sad molecular replacement (see paper)
31% identity, 82% coverage: 45:264/269 of query aligns to 23:232/234 of 3luzB
Sites not aligning to the query:
5dw8A Crystal structure of 2'amp bound saimpase-ii
31% identity, 82% coverage: 48:267/269 of query aligns to 27:248/260 of 5dw8A
5j16A Crystal structure of inositol monophosphate bound saimpase-ii
31% identity, 80% coverage: 53:267/269 of query aligns to 28:244/258 of 5j16A
2p3nA Thermotoga maritima impase tm1415 (see paper)
31% identity, 73% coverage: 41:237/269 of query aligns to 29:219/256 of 2p3nA
O33832 Fructose-1,6-bisphosphatase/inositol-1-monophosphatase; FBPase/IMPase; Inositol-1-phosphatase; I-1-Pase; EC 3.1.3.11; EC 3.1.3.25 from Thermotoga maritima (strain ATCC 43589 / DSM 3109 / JCM 10099 / NBRC 100826 / MSB8) (see paper)
31% identity, 73% coverage: 41:237/269 of query aligns to 29:219/256 of O33832
Q9M8S8 Inositol-phosphate phosphatase; L-galactose 1-phosphate phosphatase; Myo-inositol monophosphatase; EC 3.1.3.25; EC 3.1.3.93 from Arabidopsis thaliana (Mouse-ear cress) (see paper)
33% identity, 77% coverage: 30:236/269 of query aligns to 29:238/271 of Q9M8S8
4g61A Crystal structure of impase/NADP phosphatase complexed with mg2+ and phosphate (see paper)
25% identity, 81% coverage: 48:264/269 of query aligns to 40:254/264 of 4g61A
2cziA Crystal structure of human myo-inositol monophosphatase 2 (impa2) with calcium and phosphate ions (see paper)
25% identity, 91% coverage: 18:263/269 of query aligns to 4:246/259 of 2cziA
5eygB Crystal structure of impase/NADP phosphatase complexed with NADP and ca2+ (see paper)
25% identity, 81% coverage: 48:264/269 of query aligns to 41:255/265 of 5eygB
4as5A Structure of mouse inositol monophosphatase 1 (see paper)
28% identity, 77% coverage: 48:254/269 of query aligns to 39:259/274 of 4as5A
P95189 Histidinol-phosphatase; HolPase; Histidinol-phosphate phosphatase; EC 3.1.3.15 from Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) (see paper)
31% identity, 93% coverage: 15:264/269 of query aligns to 8:257/260 of P95189
O14732 Inositol monophosphatase 2; IMP 2; IMPase 2; Inositol-1(or 4)-monophosphatase 2; Myo-inositol monophosphatase A2; EC 3.1.3.25 from Homo sapiens (Human) (see 2 papers)
25% identity, 93% coverage: 13:263/269 of query aligns to 20:269/288 of O14732
5zonA Histidinol phosphate phosphatase from mycobacterium tuberculosis (see paper)
31% identity, 93% coverage: 15:264/269 of query aligns to 6:255/256 of 5zonA
5yhtA Crystal structure of a phosphatase from mycobacterium tuberculosis in complex with its substrate (see paper)
31% identity, 93% coverage: 15:264/269 of query aligns to 5:254/255 of 5yhtA
>BWI76_RS07840 FitnessBrowser__Koxy:BWI76_RS07840
MKSLESNELQARYRLACELAKAGAELAFEYYQQRDRLAVDHKGDDLQDVVSVADKRVEAF
VKQRIMDAFPQDGFLGEESGTQMPDARVLWVVDPIDGTSCFLNGLHTWCLSLAILADGEP
VIGVVYDPNHRELFHALKGQGAWLNDAPIAPHPAATVKEGVMGVGTSHRVTPALFLPFLD
ALLSDGGMFIRNGSGALMSAWAAAGRLIGYYEPHMNPWDGLPGLVLMREAGGLSNDYLTN
DGIRHGNPLLLASKTLYPQLKNMLCHPLP
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory