Comparing BWI76_RS08110 FitnessBrowser__Koxy:BWI76_RS08110 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
2ia4B Crystal structure of novel amino acid binding protein from shigella flexneri
90% identity, 92% coverage: 26:303/303 of query aligns to 1:278/278 of 2ia4B
2vhaA Debp (see paper)
91% identity, 90% coverage: 29:302/303 of query aligns to 3:276/276 of 2vhaA
8ovoA X-ray structure of the sf-iglusnfr-s72a in complex with l-aspartate
89% identity, 82% coverage: 29:275/303 of query aligns to 1:247/503 of 8ovoA
5eyfB Crystal structure of solute-binding protein from enterococcus faecium with bound glutamate
30% identity, 83% coverage: 29:278/303 of query aligns to 1:241/243 of 5eyfB
5t0wA Crystal structure of the ancestral amino acid-binding protein anccdt- 1, a precursor of cyclohexadienyl dehydratase
33% identity, 80% coverage: 32:272/303 of query aligns to 1:229/229 of 5t0wA
4zv1A An ancestral arginine-binding protein bound to arginine (see paper)
31% identity, 76% coverage: 41:271/303 of query aligns to 4:225/226 of 4zv1A
4zv2A An ancestral arginine-binding protein bound to glutamine (see paper)
31% identity, 76% coverage: 41:271/303 of query aligns to 4:223/225 of 4zv2A
6svfA Crystal structure of the p235gk mutant of argbp from t. Maritima (see paper)
28% identity, 79% coverage: 34:271/303 of query aligns to 3:227/229 of 6svfA
4ymxA Crystal structure of the substrate binding protein of an amino acid abc transporter (see paper)
29% identity, 77% coverage: 41:272/303 of query aligns to 1:223/224 of 4ymxA
2yjpA Crystal structure of the solute receptors for l-cysteine of neisseria gonorrhoeae (see paper)
25% identity, 79% coverage: 32:269/303 of query aligns to 2:229/247 of 2yjpA
2v25A Structure of the campylobacter jejuni antigen peb1a, an aspartate and glutamate receptor with bound aspartate (see paper)
26% identity, 77% coverage: 34:266/303 of query aligns to 3:229/231 of 2v25A
3k4uE Crystal structure of putative binding component of abc transporter from wolinella succinogenes dsm 1740 complexed with lysine
26% identity, 76% coverage: 41:271/303 of query aligns to 4:226/234 of 3k4uE
1xt8B Crystal structure of cysteine-binding protein from campylobacter jejuni at 2.0 a resolution (see paper)
24% identity, 80% coverage: 32:272/303 of query aligns to 5:235/251 of 1xt8B
3vv5A Crystal structure of ttc0807 complexed with (s)-2-aminoethyl-l- cysteine (aec) (see paper)
24% identity, 81% coverage: 33:278/303 of query aligns to 5:237/237 of 3vv5A
3vvfA Crystal structure of ttc0807 complexed with arginine (see paper)
24% identity, 81% coverage: 33:278/303 of query aligns to 9:241/241 of 3vvfA
3vveA Crystal structure of ttc0807 complexed with lysine (see paper)
24% identity, 81% coverage: 33:278/303 of query aligns to 9:241/241 of 3vveA
3vvdA Crystal structure of ttc0807 complexed with ornithine (see paper)
24% identity, 81% coverage: 33:278/303 of query aligns to 9:241/241 of 3vvdA
4i62A 1.05 angstrom crystal structure of an amino acid abc transporter substrate-binding protein abpa from streptococcus pneumoniae canada mdr_19a bound to l-arginine
25% identity, 80% coverage: 34:275/303 of query aligns to 1:235/237 of 4i62A
4g4pA Crystal structure of glutamine-binding protein from enterococcus faecalis at 1.5 a (see paper)
26% identity, 75% coverage: 44:271/303 of query aligns to 17:234/235 of 4g4pA
4z9nB Abc transporter / periplasmic binding protein from brucella ovis with glutathione bound
24% identity, 72% coverage: 33:250/303 of query aligns to 7:224/324 of 4z9nB
>BWI76_RS08110 FitnessBrowser__Koxy:BWI76_RS08110
MQLRKLAAAMLVMGLTAGAAHAEDAASTAGQSTLDKIAKNGVIVVGHRESSVPFSYYDNK
QQVVGYSQDYSNAIVDAIKKKLNKPDLQIKLIPVTSQNRIPLLQNGTYDFECGSTTNNLE
RQKQAAFSDTIFVVGTRLLVKKGGAIKDFPDLKDKAVVVTSGTTSEILLHKLNDEKKMNM
RIISAKDHGDSFRTLESGRAVAFMMDDALLAGERAKAKKPDNWEIVGTAQSQEAYGCMLR
KDDPQFKTLVDDTVAHVQTSGEAEKWFDKWFKNPIPPKNLNMNFELSDEMKALFKSPNDK
ALN
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory