Comparing BWI76_RS08245 FitnessBrowser__Koxy:BWI76_RS08245 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 15 hits to proteins with known functional sites (download)
A0A0H2VG78 Glucose transporter GlcP; Glucose/H(+) symporter from Staphylococcus epidermidis (strain ATCC 12228 / FDA PCI 1200) (see paper)
23% identity, 81% coverage: 68:418/431 of query aligns to 53:418/446 of A0A0H2VG78
Sites not aligning to the query:
6rw3A The molecular basis for sugar import in malaria parasites. (see paper)
27% identity, 47% coverage: 29:230/431 of query aligns to 17:211/437 of 6rw3A
Sites not aligning to the query:
5c65A Structure of the human glucose transporter glut3 / slc2a3
26% identity, 43% coverage: 44:228/431 of query aligns to 50:223/457 of 5c65A
Sites not aligning to the query:
7sptA Crystal structure of exofacial state human glucose transporter glut3 (see paper)
26% identity, 41% coverage: 54:228/431 of query aligns to 65:227/470 of 7sptA
Sites not aligning to the query:
7crzA Crystal structure of human glucose transporter glut3 bound with c3361 (see paper)
26% identity, 43% coverage: 44:228/431 of query aligns to 52:225/469 of 7crzA
Sites not aligning to the query:
4zw9A Crystal structure of human glut3 bound to d-glucose in the outward- occluded conformation at 1.5 angstrom (see paper)
26% identity, 43% coverage: 44:228/431 of query aligns to 54:227/470 of 4zw9A
Sites not aligning to the query:
7spsA Crystal structure of human glucose transporter glut3 bound with exofacial inhibitor sa47 (see paper)
26% identity, 43% coverage: 44:228/431 of query aligns to 51:224/468 of 7spsA
Sites not aligning to the query:
P11169 Solute carrier family 2, facilitated glucose transporter member 3; Glucose transporter type 3, brain; GLUT-3 from Homo sapiens (Human) (see paper)
26% identity, 43% coverage: 44:228/431 of query aligns to 54:227/496 of P11169
Sites not aligning to the query:
6m20B Crystal structure of plasmodium falciparum hexose transporter pfht1 bound with glucose (see paper)
26% identity, 47% coverage: 29:230/431 of query aligns to 17:231/478 of 6m20B
Sites not aligning to the query:
P32037 Solute carrier family 2, facilitated glucose transporter member 3; Glucose transporter type 3, brain; GLUT-3 from Mus musculus (Mouse) (see paper)
24% identity, 69% coverage: 43:341/431 of query aligns to 53:377/493 of P32037
Sites not aligning to the query:
Q9LT15 Sugar transport protein 10; AtSTP10; D-glucose-H(+) symport protein STP10; D-glucose-proton symporter STP10; Hexose transporter 10 from Arabidopsis thaliana (Mouse-ear cress) (see 2 papers)
27% identity, 35% coverage: 80:230/431 of query aligns to 105:246/514 of Q9LT15
Sites not aligning to the query:
P77589 3-(3-hydroxy-phenyl)propionate transporter; 3HPP transporter; 3-(3-hydroxy-phenyl)propionate:H(+) symporter; 3HPP:H(+) symporter from Escherichia coli (strain K12) (see paper)
27% identity, 40% coverage: 58:228/431 of query aligns to 55:210/403 of P77589
Sites not aligning to the query:
7aaqA Sugar/h+ symporter stp10 in outward occluded conformation (see paper)
27% identity, 35% coverage: 80:230/431 of query aligns to 85:226/487 of 7aaqA
Sites not aligning to the query:
O23492 Inositol transporter 4; Myo-inositol-proton symporter INT4; Protein INOSITOL TRANSPORTER 4 from Arabidopsis thaliana (Mouse-ear cress) (see paper)
28% identity, 35% coverage: 78:230/431 of query aligns to 92:230/582 of O23492
Sites not aligning to the query:
7aarA Sugar/h+ symporter stp10 in inward open conformation (see paper)
27% identity, 35% coverage: 80:230/431 of query aligns to 90:231/485 of 7aarA
Sites not aligning to the query:
>BWI76_RS08245 FitnessBrowser__Koxy:BWI76_RS08245
MTQPSSRAGTIGAILRVTSGNFLEQFDFFLFGFYATYIARTFFPAESEFAALMLTFAVFG
SGFLMRPIGAIVLGAYIDRIGRRKGLMVTLAIMGCGTLLIALVPGYQTIGILAPILVVVG
RLLQGFSAGVELGGVSVYLSEIATPGNKGFYTSWQSASQQVAIVVAALIGYALNETLGHD
QIAEWGWRIPFFIGCMIIPLIFVLRRSLQETEAFLQRKHRPDTREILSTIVKNWRIISAG
TLLVAMTTTTFYFITVYTPTYGRAVLHLSARDSLLVTMLVGISNFIWLPIGGAISDKIGR
RPVLMGITLLALLTTWPVMHWLTAAPDFTRMTLVLLWFSFFFGMYNGAMVAALTEVMPVY
VRTVGFSLAFSLATAIFGGLTPAISTALVEITGDKSSPGWWLMCAALCGFAATAMLFVRL
SRGYRPAEIPR
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory