Comparing BWI76_RS08385 FitnessBrowser__Koxy:BWI76_RS08385 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
P0ABH7 Citrate synthase; EC 2.3.3.16 from Escherichia coli (strain K12) (see 2 papers)
96% identity, 100% coverage: 1:427/427 of query aligns to 1:427/427 of P0ABH7
1owbA Three dimensional structure analysis of the variant r109l nadh complex of type ii citrate synthase from e. Coli (see paper)
96% identity, 100% coverage: 2:427/427 of query aligns to 1:426/426 of 1owbA
1nxgA The f383a variant of type ii citrate synthase complexed with nadh (see paper)
96% identity, 100% coverage: 2:427/427 of query aligns to 1:426/426 of 1nxgA
4jagA Structural determination of the a50t:s279g:s280k:v281k:k282e:h283n variant of citrate synthase from e. Coli complexed with oxaloacetate (see paper)
96% identity, 100% coverage: 2:427/427 of query aligns to 1:426/426 of 4jagA
4jaeA Structural determination of the a50t:s279g:s280k:v281k:k282e:h283n variant of citrate synthase from e. Coli complexed with s- carboxymethyl-coa (see paper)
96% identity, 100% coverage: 2:427/427 of query aligns to 1:426/426 of 4jaeA
2h12B Structure of acetobacter aceti citrate synthase complexed with oxaloacetate and carboxymethyldethia coenzyme a (cmx) (see paper)
66% identity, 98% coverage: 4:421/427 of query aligns to 1:420/426 of 2h12B
P9WPD5 Citrate synthase 1; EC 2.3.3.16 from Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) (see paper)
52% identity, 100% coverage: 1:427/427 of query aligns to 1:431/431 of P9WPD5
3msuB Crystal structure of citrate synthase from francisella tularensis
53% identity, 95% coverage: 16:421/427 of query aligns to 23:426/426 of 3msuB
3msuA Crystal structure of citrate synthase from francisella tularensis
52% identity, 95% coverage: 16:421/427 of query aligns to 23:415/415 of 3msuA
4tvmA Structure of citrate synthase from mycobacterium tuberculosis (see paper)
47% identity, 95% coverage: 16:421/427 of query aligns to 11:377/380 of 4tvmA
6abwA Crystal structure of citrate synthase (msed_0281) from metallosphaera sedula in complex with acetyl-coa (see paper)
36% identity, 86% coverage: 55:420/427 of query aligns to 8:362/369 of 6abwA
1aj8A Citrate synthase from pyrococcus furiosus (see paper)
37% identity, 85% coverage: 54:415/427 of query aligns to 12:358/371 of 1aj8A
6abxA Crystal structure of citrate synthase (msed_1522) from metallosphaera sedula in complex with citrate (see paper)
35% identity, 87% coverage: 46:415/427 of query aligns to 6:358/370 of 6abxA
6abyA Crystal structure of citrate synthase (msed_1522) from metallosphaera sedula in complex with oxaloacetate (see paper)
35% identity, 87% coverage: 46:415/427 of query aligns to 6:358/372 of 6abyA
1ixeA Crystal structure of citrate synthase from thermus thermophilus hb8 (see paper)
35% identity, 87% coverage: 46:415/427 of query aligns to 4:359/371 of 1ixeA
1iomA Crystal structure of citrate synthase from thermus thermophilus hb8 (see paper)
35% identity, 87% coverage: 46:415/427 of query aligns to 4:362/374 of 1iomA
P39120 Citrate synthase 2; Citrate synthase II; EC 2.3.3.16 from Bacillus subtilis (strain 168) (see paper)
35% identity, 88% coverage: 46:421/427 of query aligns to 6:365/372 of P39120
6s87D Crystal structure of 2-methylcitrate synthase (prpc) from pseudomonas aeruginosa in complex with oxaloacetate.
31% identity, 88% coverage: 46:421/427 of query aligns to 1:359/365 of 6s87D
2r9eA The structure of the binary complex of citryl dethia coa and citrate synthase from the thermophilic archaeonthermoplasma acidophilum
32% identity, 86% coverage: 55:421/427 of query aligns to 16:375/381 of 2r9eA
2r26A The structure of the ternary complex of carboxymethyl coenzyme a and oxalateacetate with citrate synthase from the thermophilic archaeonthermoplasma acidophilum
32% identity, 86% coverage: 55:421/427 of query aligns to 16:375/381 of 2r26A
>BWI76_RS08385 FitnessBrowser__Koxy:BWI76_RS08385
MSDAKAKITLGGDTAIELDVLKGTLGQDVIDIRSLGSKGVFTFDPGFTSTASCESKITFI
DGDEGILLHRGFPIDQLATDSNYLEVCYILLNGEKPTQAQYDEFKTIVTRHTMIHEQITR
LFHAFRRDSHPMAVMCGITGALAAFYHDSLDVNNPRHRDIAAFRLLSKMPTMAAMCYKYS
IGQPFVYPRNDLSYAGNFLNMMFSTPCEKYEVNPILERAMDRILILHADHEQNASTSTVR
TAGSSGANPFACIAAGIASLWGPAHGGANEAALKMLEEISSVEHIPEFVRRAKDKNDSFR
LMGFGHRVYKNYDPRATVMRETCHEVLKELGTKDDLLEVAMELEHIALNDPYFIEKKLYP
NVDFYSGIILKAMGIPSSMFTVIFAMARTVGWIAHWNEMHSDGMKIARPRQLYTGYEKRD
FKNDIAR
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory