SitesBLAST
Comparing BWI76_RS08475 FitnessBrowser__Koxy:BWI76_RS08475 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 4 hits to proteins with known functional sites (download)
O66145 Methylaspartate ammonia-lyase; MAL; 3-methylaspartate ammonia-lyase; Beta-methylaspartase; EC 4.3.1.2 from Citrobacter amalonaticus (see paper)
97% identity, 100% coverage: 1:413/413 of query aligns to 1:413/413 of O66145
- Q172 (= Q172) binding
- D238 (= D238) binding
- E273 (= E273) binding
- D307 (= D307) binding
- Q329 (= Q329) binding
- K331 (= K331) active site, Proton acceptor
1kkrA Crystal structure of citrobacter amalonaticus methylaspartate ammonia lyase containing (2s,3s)-3-methylaspartic acid (see paper)
97% identity, 100% coverage: 1:411/413 of query aligns to 1:411/411 of 1kkrA
- active site: Q172 (= Q172), H194 (= H194), D238 (= D238), E273 (= E273), D307 (= D307), Q329 (= Q329), K331 (= K331)
- binding (2S,3S)-3-methyl-aspartic acid: Q172 (= Q172), H194 (= H194), D238 (= D238), T360 (= T360), C361 (= C361)
- binding magnesium ion: D238 (= D238), E273 (= E273), D307 (= D307)
Q05514 Methylaspartate ammonia-lyase; MAL; 3-methylaspartase ammonia-lyase; Beta-methylaspartase; EC 4.3.1.2 from Clostridium tetanomorphum (see 3 papers)
57% identity, 99% coverage: 1:409/413 of query aligns to 1:409/413 of Q05514
- Q73 (= Q73) mutation to A: It has very broad nucleophile scope and excellent regio- and diastereoselectivity in the amination reaction. This mutation strongly moves the specificity of MAL away from ammonia and towards methylamine. It is highly enantioselective.
- H194 (= H194) mutation to A: Strong (160-fold) decrease of the catalytic efficiency for deamination and slight (1.8-fold) decrease of affinity binding for L-threo-beta-methylaspartate. 7-fold decrease of the catalytic efficiency for amination and 20-fold decrease of affinity binding for mesaconate. It does not show any major conformational changes.; mutation to R: It abolishes deaminase and aminase activities and does not show any major conformational changes.
- D238 (= D238) binding
- E273 (= E273) binding
- D307 (= D307) binding
- Q329 (= Q329) mutation to A: Very strong decrease of the catalytic efficiency for deamination, whereas the affinity binding for L-threo-beta-methylaspartate is not affected. Strong (240-fold) decrease of the catalytic efficiency for amination and slight (2.4-fold) decrease of affinity binding for mesaconate. It does not show any major conformational changes.; mutation to R: It abolishes deaminase and aminase activities and does not show any major conformational changes.
- K331 (= K331) active site, Proton acceptor; mutation to A: It abolishes deaminase and aminase activities and does not show any major conformational changes.; mutation to G: It abolishes deaminase and aminase activities and does not show any major conformational changes.; mutation to H: It abolishes deaminase and aminase activities and does not show any major conformational changes.; mutation to Q: It abolishes deaminase and aminase activities and does not show any major conformational changes.; mutation to R: It abolishes deaminase and aminase activities and does not show any major conformational changes.
- L384 (= L384) mutation to A: It has very broad electrophile scope and excellent regio- and enantioselectivity in the amination reaction.
3zvhA Methylaspartate ammonia lyase from clostridium tetanomorphum mutant q73a (see paper)
57% identity, 99% coverage: 1:409/413 of query aligns to 1:409/415 of 3zvhA
Query Sequence
>BWI76_RS08475 FitnessBrowser__Koxy:BWI76_RS08475
MKIKQALFTAGYSSFYFDDQQAIKNGAGHDGFIYTGAPVTPGFTSVRQAGECVSVQLILE
NGAVAVGDCAAVQYSGAGGRDPLFLAENFIPFLNDHIKPLLEGRDVDTFLPNARFFDKLR
IDGHLLHTAVRYGLSQALLDATALASGRLKAEVVCDEWQLPCIPEAIPLFGQSGDDRYIA
VDKMILKGVDVLPHALINNVEEKLGLKGEKLREYVRWLSDRILSLRASPRYRPTLHIDVY
GTIGLIFDMDPVRCADYIASLEKEAQGLPLYIEGPVDAGNKPDQIRMLTAITKELTRLGS
GVKIVADEWCNTYQDIIDFTDAGSCHMVQIKTPDLGGIHNIVDAVLYCNKHAMEAYQGGT
CNETEISARTCVHVALAARPMRMLIKPGMGFDEGLNIVFNEMNRTIALLQAKD
Or try a new SitesBLAST search
SitesBLAST's Database
SitesBLAST's database includes
(1) SwissProt
entries with experimentally-supported functional features;
and (2) protein structures with bound ligands, from the
BioLip database.
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory