SitesBLAST
Comparing BWI76_RS08480 FitnessBrowser__Koxy:BWI76_RS08480 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 5 hits to proteins with known functional sites (download)
6h9fB Structure of glutamate mutase reconstituted with bishomo-coenzyme b12 (see paper)
59% identity, 100% coverage: 1:481/481 of query aligns to 1:482/483 of 6h9fB
- active site: R100 (= R99), E171 (= E170)
- binding (2~{R},3~{R},4~{S},5~{R})-2-(6-aminopurin-9-yl)-5-propyl-oxolane-3,4-diol: R66 (= R67), A67 (= A68), G68 (= G69), T94 (= T93), N123 (= N122), K326 (= K325), E330 (= E329), I334 (= I333), P335 (= P334)
- binding cobalamin: A97 (= A96), R100 (= R99), N123 (= N122), Y181 (= Y180), T220 (= T219), M294 (= M293), G295 (= G294), G296 (= G295), F297 (= F296), E330 (= E329), G333 (= G332), I334 (= I333), P410 (= P409), F471 (≠ N470)
6h9eB Structure of glutamate mutase reconstituted with homo-coenzyme b12 (see paper)
59% identity, 100% coverage: 1:481/481 of query aligns to 1:482/483 of 6h9eB
- active site: R100 (= R99), E171 (= E170)
- binding cobalamin: A97 (= A96), R100 (= R99), N123 (= N122), Y181 (= Y180), T220 (= T219), M294 (= M293), G295 (= G294), G296 (= G295), F297 (= F296), E330 (= E329), G333 (= G332), I334 (= I333), F471 (≠ N470)
- binding (2~{R},3~{R},4~{S},5~{R})-2-(6-aminopurin-9-yl)-5-ethyl-oxolane-3,4-diol: R66 (= R67), A67 (= A68), G68 (= G69), T94 (= T93), N123 (= N122), K326 (= K325), E330 (= E329), I334 (= I333), P335 (= P334)
1i9cB Glutamate mutase from clostridium cochlearium: complex with adenosylcobalamin and substrate (see paper)
59% identity, 100% coverage: 1:481/481 of query aligns to 1:482/483 of 1i9cB
- active site: R100 (= R99), E171 (= E170)
- binding (2S,3S)-3-methyl-aspartic acid: R66 (= R67), R100 (= R99), R149 (= R148), H150 (= H149), E171 (= E170), Y177 (= Y176), Y181 (= Y180), F216 (= F215)
- binding cobalamin: A97 (= A96), R100 (= R99), N123 (= N122), T220 (= T219), M294 (= M293), G295 (= G294), G296 (= G295), F297 (= F296), E330 (= E329), G333 (= G332), I334 (= I333), F471 (≠ N470)
- binding glutamic acid: R66 (= R67), R100 (= R99), R149 (= R148), H150 (= H149), E171 (= E170), Y177 (= Y176), Y181 (= Y180), F216 (= F215)
1ccwB Structure of the coenzyme b12 dependent enzyme glutamate mutase from clostridium cochlearium (see paper)
59% identity, 100% coverage: 1:481/481 of query aligns to 1:482/483 of 1ccwB
- active site: R100 (= R99), E171 (= E170)
- binding cyanocobalamin: R100 (= R99), Y181 (= Y180), T220 (= T219), M294 (= M293), G295 (= G294), G296 (= G295), F297 (= F296), E330 (= E329), A331 (= A330), G333 (= G332), I334 (= I333), F471 (≠ N470)
1cb7B Glutamate mutase from clostridium cochlearium reconstituted with methyl-cobalamin (see paper)
59% identity, 100% coverage: 1:481/481 of query aligns to 1:482/483 of 1cb7B
- active site: R100 (= R99), E171 (= E170)
- binding co-methylcobalamin: R100 (= R99), Y181 (= Y180), T220 (= T219), M294 (= M293), G295 (= G294), G296 (= G295), F297 (= F296), E330 (= E329), G333 (= G332), I334 (= I333), F471 (≠ N470)
Query Sequence
>BWI76_RS08480 FitnessBrowser__Koxy:BWI76_RS08480
MELRNKKLTHDEFMTERHQVLQTWHTGKDVEHFEDGVKYQQTIPEKKRFSHALLKADQEG
KTLSQPRAGVALMDEHIALLKTLQEECDLLPSTIDAYTRLNRYEEAAVGIQKSIEAGTSK
LNGLPVVNHGVAECRRMTEALEKPVQVRHGTPDARLLAEISMASGFTSYEGGGISYNIPY
AKRVTLEKSIRDWQYCDRLMGLYEEHGIRINREPFGPLTGTLIPPFMSHAVAIIEGLLAL
EQGVKSITVGYGQVGSLTQDIAAIRSLRELSHEYFGNYGFDDYELSTVFHQWMGGFPEDE
SKAFAIISWGAAVAGMSGATKVITKSPHEAFGIPTAAANAQGLKASRQMLNMVSDQKFPP
CAAVDQEVELIKSEVRAVLKKVFELGNGDIARGTVLAFEAGVLDVPFAPASCNAGKILPV
RDNSGAIRVLEAGAVPLPKDILALHHDYVAERAQFEGRKPSFQMVVDDINAVSHSKLIGR
P
Or try a new SitesBLAST search
SitesBLAST's Database
SitesBLAST's database includes
(1) SwissProt
entries with experimentally-supported functional features;
and (2) protein structures with bound ligands, from the
BioLip database.
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory