SitesBLAST
Comparing BWI76_RS08615 FitnessBrowser__Koxy:BWI76_RS08615 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
P0A6T3 Galactokinase; Galactose kinase; EC 2.7.1.6 from Escherichia coli (strain K12) (see 2 papers)
90% identity, 100% coverage: 1:382/382 of query aligns to 1:382/382 of P0A6T3
- M1 (= M1) modified: Initiator methionine, Removed
- Y371 (= Y371) mutation to H: Displays relaxed substrate specificity since it gains kinase activity toward sugars as diverse as D-galacturonic acid, D-talose, L-altrose, and L-glucose. Also shows enhanced turnover of the small pool of sugars converted by the wild-type enzyme.
6q90C Structure of human galactokinase 1 bound with 1-(4-methoxyphenyl)-3- (4-pyridinyl)urea
43% identity, 97% coverage: 11:379/382 of query aligns to 20:386/391 of 6q90C
- binding beta-D-galactopyranose: E43 (= E34), H44 (= H35), D46 (= D37), Y47 (= Y38), G182 (= G171), D185 (= D174)
- binding 2-(1,3-benzoxazol-2-ylamino)spiro[1,6,7,8-tetrahydroquinazoline-4,1'-cyclohexane]-5-one: R104 (≠ Q91), W105 (= W92), Y108 (= Y95), L134 (≠ Q123), S140 (= S129), L144 (= L133)
- binding N-(4-methoxyphenyl)-N'-pyridin-4-ylurea: L212 (≠ M201), D214 (vs. gap), P215 (= P202), L217 (≠ V205), L354 (= L343), Q381 (≠ K374)
6q8zA Structure of human galactokinase 1 bound with n-(cyclobutylmethyl)-1, 5-dimethyl-1h-pyrazole-4-carboxamide
43% identity, 97% coverage: 11:379/382 of query aligns to 20:387/392 of 6q8zA
- binding beta-D-galactopyranose: E43 (= E34), H44 (= H35), D46 (= D37), Y47 (= Y38), G183 (= G171), M185 (= M173), D186 (= D174), Y236 (= Y223), G345 (= G333), G346 (= G334)
- binding 2-(1,3-benzoxazol-2-ylamino)spiro[1,6,7,8-tetrahydroquinazoline-4,1'-cyclohexane]-5-one: R105 (≠ Q91), Y109 (= Y95), V129 (≠ I117), L135 (≠ Q123), G136 (= G124), S141 (= S129), S142 (= S130)
- binding ~{N}-(cyclobutylmethyl)-1,5-dimethyl-pyrazole-4-carboxamide: A31 (≠ V22), V32 (≠ I23), S33 (≠ Q24)
Sites not aligning to the query:
6q3wC Structure of human galactokinase 1 bound with ethyl 1-(2-pyrazinyl)-4- piperidinecarboxylate
44% identity, 97% coverage: 11:379/382 of query aligns to 19:385/390 of 6q3wC
- binding beta-D-galactopyranose: E42 (= E34), H43 (= H35), D45 (= D37), Y46 (= Y38), G182 (= G171), M184 (= M173), D185 (= D174), Y235 (= Y223), G344 (= G334)
- binding 2-(1,3-benzoxazol-2-ylamino)spiro[1,6,7,8-tetrahydroquinazoline-4,1'-cyclohexane]-5-one: D82 (≠ N73), R104 (≠ Q91), W105 (= W92), Y108 (= Y95), V128 (≠ I117), S130 (≠ G119), L134 (≠ Q123), S140 (= S129), S141 (= S130), R227 (≠ K215)
- binding ethyl 1-pyrazin-2-ylpiperidine-4-carboxylate: R104 (≠ Q91), N107 (= N94), Y108 (= Y95), A177 (≠ V166), G178 (= G167)
6q3xA Structure of human galactokinase in complex with galactose and 2'- (benzo[d]oxazol-2-ylamino)-7',8'-dihydro-1'h-spiro[cyclohexane-1,4'- quinazolin]-5'(6'h)-one (see paper)
43% identity, 97% coverage: 11:379/382 of query aligns to 21:388/393 of 6q3xA
- binding beta-D-galactopyranose: E44 (= E34), H45 (= H35), D47 (= D37), G184 (= G171), M186 (= M173), D187 (= D174), Y237 (= Y223), G347 (= G334)
- binding 2-(1,3-benzoxazol-2-ylamino)spiro[1,6,7,8-tetrahydroquinazoline-4,1'-cyclohexane]-5-one: Y110 (= Y95), L136 (≠ Q123), S142 (= S129), S143 (= S130), L146 (= L133)
7s4cA Crystal structure of inhibitor-bound galactokinase (see paper)
43% identity, 97% coverage: 11:379/382 of query aligns to 19:386/391 of 7s4cA
- binding alpha-D-galactopyranose: E42 (= E34), H43 (= H35), D45 (= D37), Y46 (= Y38), G182 (= G171), D185 (= D174), Y235 (= Y223), G345 (= G334)
- binding phosphate ion: G135 (= G124), G137 (= G126), S139 (= S128), S140 (= S129), S141 (= S130), Q171 (≠ E160), H174 (≠ N163), H362 (≠ T351), H366 (≠ A355), E369 (≠ K358)
- binding 2-({(4R)-4-(2-chlorophenyl)-2-[(6-fluoro-1,3-benzoxazol-2-yl)amino]-6-methyl-1,4-dihydropyrimidine-5-carbonyl}amino)pyridine-4-carboxylic acid: M54 (≠ C46), D82 (≠ N73), R104 (≠ Q91), W105 (= W92), Y108 (= Y95), L134 (≠ Q123), S140 (= S129), L144 (= L133), K194 (= K183), L212 (≠ M201), D214 (vs. gap), L217 (≠ V205), A218 (= A206), V219 (= V207), L294 (= L282), F302 (≠ M290), L354 (= L343), S380 (≠ C373), Q381 (≠ K374), A382 (≠ P375)
7s49A Crystal structure of inhibitor-bound galactokinase (see paper)
43% identity, 97% coverage: 11:379/382 of query aligns to 19:386/391 of 7s49A
- binding (4R)-2-[(1,3-benzoxazol-2-yl)amino]-4-(4-chloro-1H-pyrazol-5-yl)-4,6,7,8-tetrahydroquinazolin-5(1H)-one: S78 (≠ A69), D82 (≠ N73), R104 (≠ Q91), W105 (= W92), Y108 (= Y95), V128 (≠ I117), L134 (≠ Q123), S140 (= S129), S141 (= S130), L144 (= L133), R227 (≠ K215)
- binding alpha-D-galactopyranose: E42 (= E34), H43 (= H35), D45 (= D37), Y46 (= Y38), G182 (= G171), D185 (= D174), Y235 (= Y223)
- binding phosphate ion: G135 (= G124), G137 (= G126), S139 (= S128), S140 (= S129), S141 (= S130), Q171 (≠ E160), H174 (≠ N163), H362 (≠ T351), H366 (≠ A355)
7rclA Crystal structure of adp-bound galactokinase (see paper)
43% identity, 97% coverage: 11:379/382 of query aligns to 19:386/391 of 7rclA
- binding adenosine-5'-diphosphate: T76 (≠ A68), S78 (≠ A69), W105 (= W92), Y108 (= Y95), G135 (= G124), G137 (= G126), S139 (= S128), S140 (= S129), S141 (= S130), L144 (= L133), H228 (≠ R216)
- binding alpha-D-galactopyranose: E42 (= E34), H43 (= H35), D45 (= D37), Y46 (= Y38), C181 (= C170), G182 (= G171), M184 (= M173), D185 (= D174), Y235 (= Y223)
- binding phosphate ion: H362 (≠ T351), H366 (≠ A355)
7ozxB Structure of human galactokinase 1 bound with azepan-1-yl(2,6- difluorophenyl)methanone
43% identity, 97% coverage: 11:379/382 of query aligns to 19:386/391 of 7ozxB
- binding beta-D-galactopyranose: E42 (= E34), H43 (= H35), D45 (= D37), Y46 (= Y38), G182 (= G171), M184 (= M173), D185 (= D174), Y235 (= Y223), G345 (= G334)
- binding 2-(1,3-benzoxazol-2-ylamino)spiro[1,6,7,8-tetrahydroquinazoline-4,1'-cyclohexane]-5-one: S78 (≠ A69), D82 (≠ N73), R104 (≠ Q91), Y108 (= Y95), S130 (≠ G119), L134 (≠ Q123), S140 (= S129), S141 (= S130), L144 (= L133)
- binding (azepan-1-yl)(2,6-difluorophenyl)methanone: S32 (≠ Q24)
Sites not aligning to the query:
6zgyA Structure of human galactokinase 1 bound with 2-(4-chlorophenyl)-n- (pyrimidin-2-yl)acetamide (see paper)
43% identity, 97% coverage: 11:379/382 of query aligns to 19:386/391 of 6zgyA
- binding beta-D-galactopyranose: E42 (= E34), H43 (= H35), D45 (= D37), Y46 (= Y38), G182 (= G171), M184 (= M173), D185 (= D174), Y235 (= Y223)
- binding 2-(1,3-benzoxazol-2-ylamino)spiro[1,6,7,8-tetrahydroquinazoline-4,1'-cyclohexane]-5-one: D82 (≠ N73), R104 (≠ Q91), W105 (= W92), V128 (≠ I117), S130 (≠ G119), L134 (≠ Q123), S140 (= S129), L144 (= L133)
- binding (2,5-dimethylphenyl) pyridine-4-carboxylate: L212 (≠ M201), D214 (vs. gap), L217 (≠ V205), L294 (= L282), F302 (≠ M290), L354 (= L343)
6qjeA Structure of human galactokinase 1 bound with 4-{[2-(methylsulfonyl)- 1h-imidazol-1-yl]methyl}-1,3-thiazole
43% identity, 97% coverage: 11:379/382 of query aligns to 18:385/390 of 6qjeA
- binding beta-D-galactopyranose: E41 (= E34), H42 (= H35), D44 (= D37), Y45 (= Y38), G181 (= G171), M183 (= M173), D184 (= D174), Y234 (= Y223), G344 (= G334)
- binding 2-(1,3-benzoxazol-2-ylamino)spiro[1,6,7,8-tetrahydroquinazoline-4,1'-cyclohexane]-5-one: S77 (≠ A69), Y107 (= Y95), V127 (≠ I117), S129 (≠ G119), L133 (≠ Q123), S139 (= S129), S140 (= S130), R226 (≠ K215)
- binding 4-[(2-methylsulfonylimidazol-1-yl)methyl]-1,3-thiazole: R103 (≠ Q91), A176 (≠ V166), G177 (= G167)
6q91A Structure of human galactokinase 1 bound with 5-chloro-n-isobutyl-2- methoxybenzamide
43% identity, 97% coverage: 11:379/382 of query aligns to 20:387/392 of 6q91A
- binding beta-D-galactopyranose: E43 (= E34), H44 (= H35), D46 (= D37), Y47 (= Y38), C182 (= C170), G183 (= G171), M185 (= M173), D186 (= D174), Y236 (= Y223), G346 (= G334)
- binding 2-(1,3-benzoxazol-2-ylamino)spiro[1,6,7,8-tetrahydroquinazoline-4,1'-cyclohexane]-5-one: R105 (≠ Q91), W106 (= W92), Y109 (= Y95), S131 (≠ G119), L135 (≠ Q123), G136 (= G124), S141 (= S129)
- binding 5-chloranyl-2-methoxy-~{N}-(2-methylpropyl)benzamide: L213 (≠ M201), S214 (vs. gap), D215 (vs. gap), L218 (≠ V205), L295 (= L282), G298 (= G285), D299 (= D286), Y300 (≠ L287), F303 (≠ M290), L355 (= L343)
6zh0A Structure of human galactokinase 1 bound with 2-(4-chlorophenyl)-n- (pyrimidin-2-yl)acetamide (see paper)
43% identity, 97% coverage: 11:379/382 of query aligns to 19:385/390 of 6zh0A
- binding beta-D-galactopyranose: R36 (= R28), E42 (= E34), H43 (= H35), D45 (= D37), G182 (= G171), M184 (= M173), D185 (= D174), Y235 (= Y223), G345 (= G334)
- binding 2-(1,3-benzoxazol-2-ylamino)spiro[1,6,7,8-tetrahydroquinazoline-4,1'-cyclohexane]-5-one: D82 (≠ N73), R104 (≠ Q91), W105 (= W92), L134 (≠ Q123), S140 (= S129), L144 (= L133)
- binding N-(3-chlorophenyl)-2,2,2-trifluoroacetamide: L212 (≠ M201), L294 (= L282), G297 (= G285), D298 (= D286), Y299 (≠ L287), F302 (≠ M290), L354 (= L348)
1wuuA Crystal structure of human galactokinase complexed with mgamppnp and galactose (see paper)
43% identity, 97% coverage: 11:379/382 of query aligns to 21:386/391 of 1wuuA
- binding phosphoaminophosphonic acid-adenylate ester: T78 (≠ A68), S80 (≠ A69), W107 (= W92), Y110 (= Y95), L136 (≠ Q123), G137 (= G124), G139 (= G126), S141 (= S128), S142 (= S129), S143 (= S130), L146 (= L133)
- binding alpha-D-galactopyranose: E44 (= E34), H45 (= H35), D47 (= D37), Y48 (= Y38), G184 (= G171), M186 (= M173), D187 (= D174), Y235 (= Y223)
6zfhA Structure of human galactokinase in complex with galactose and 2'- (benzo[d]oxazol-2-ylamino)-7',8'-dihydro-1'h-spiro[cyclopentane-1,4'- quinazolin]-5'(6'h)-one (see paper)
43% identity, 97% coverage: 11:379/382 of query aligns to 18:381/386 of 6zfhA
- binding beta-D-galactopyranose: E41 (= E34), H42 (= H35), D44 (= D37), G181 (= G171), M183 (= M173), D184 (= D174), Y230 (= Y223), G340 (= G334)
- binding 2-(1,3-benzoxazol-2-ylamino)spiro[1,6,7,8-tetrahydroquinazoline-4,1'-cyclopentane]-5-one: W104 (= W92), Y107 (= Y95), L133 (≠ Q123), S139 (= S129), S140 (= S130), L143 (= L133)
6gr2A Structure of human galactokinase in complex with galactose and adp
43% identity, 97% coverage: 11:379/382 of query aligns to 17:378/383 of 6gr2A
- binding adenosine-5'-diphosphate: T74 (≠ A68), S76 (≠ A69), Y106 (= Y95), L132 (≠ Q123), G133 (= G124), G135 (= G126), S137 (= S128), S138 (= S129), S139 (= S130)
- binding beta-D-galactopyranose: E40 (= E34), H41 (= H35), D43 (= D37), G180 (= G171), D183 (= D174), Y227 (= Y223)
6zgvD Structure of human galactokinase 1 bound with 2-(4-chlorophenyl)-n- (pyrimidin-2-yl)acetamide (see paper)
43% identity, 97% coverage: 11:379/382 of query aligns to 13:367/372 of 6zgvD
6zgwD Structure of human galactokinase 1 bound with (4-chlorophenyl)methyl pyridine-3-carboxylate (see paper)
43% identity, 93% coverage: 23:379/382 of query aligns to 24:366/371 of 6zgwD
6zgzD Structure of human galactokinase 1 bound with 2-(4-chlorophenyl)-n- (pyrimidin-2-yl)acetamide (see paper)
43% identity, 93% coverage: 23:379/382 of query aligns to 24:363/368 of 6zgzD
6zgxD Structure of human galactokinase 1 bound with 2-(4-chlorophenyl)-n- (pyrimidin-2-yl)acetamide (see paper)
43% identity, 93% coverage: 23:379/382 of query aligns to 16:354/359 of 6zgxD
Query Sequence
>BWI76_RS08615 FitnessBrowser__Koxy:BWI76_RS08615
MSLKENTQALFAEKFGYPASHVIQAPGRVNLIGEHTDYNDGFVLPCAIDYQTVIACAPRD
DRTVRVIAADYANQTDEFSLDSPITSHDTQQWSNYVRGVVKHLQQRNNAFGGADLLISGN
VPQGAGLSSSASLEVAVGTVFQQLYHLPLDGAQIALNGQEAENQFVGCNCGIMDQLISAL
GKKDHALLIDCRTLGTKAVSMPKGVAVVIINSNFKRTLVGSEYNTRREQCETGARFFQQP
ALRDVTLQEFNAVAHELDPVVAKRVRHVLTENARTVEAAAALEKGDLQRMGELMAESHAS
MRDDFEITVPQIDTLVDIVKATIGDKGGVRMTGGGFGGCIVALVPEDLVDTVQQAVAKEY
EAKTGIKETFYVCKPSQGAGQC
Or try a new SitesBLAST search
SitesBLAST's Database
SitesBLAST's database includes
(1) SwissProt
entries with experimentally-supported functional features;
and (2) protein structures with bound ligands, from the
BioLip database.
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory