Comparing BWI76_RS08725 FitnessBrowser__Koxy:BWI76_RS08725 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
4mynA Crystal structure of trypanosoma cruzi formiminoglutamase n114h variant with mn2+2 (see paper)
32% identity, 79% coverage: 45:294/318 of query aligns to 19:272/298 of 4mynA
3pzlB The crystal structure of agmatine ureohydrolase of thermoplasma volcanium
28% identity, 79% coverage: 63:314/318 of query aligns to 39:283/293 of 3pzlB
6dktA Crystal structure of arginase from bacillus subtilis
26% identity, 84% coverage: 46:313/318 of query aligns to 3:277/283 of 6dktA
6dktE Crystal structure of arginase from bacillus subtilis
27% identity, 83% coverage: 46:310/318 of query aligns to 3:259/268 of 6dktE
1wogA Crystal structure of agmatinase reveals structural conservation and inhibition mechanism of the ureohydrolase superfamily (see paper)
26% identity, 89% coverage: 30:312/318 of query aligns to 12:293/303 of 1wogA
3m1rD The crystal structure of formimidoylglutamase from bacillus subtilis subsp. Subtilis str. 168
23% identity, 79% coverage: 58:309/318 of query aligns to 49:308/321 of 3m1rD
6nfpD 1.7 angstrom resolution crystal structure of arginase from bacillus subtilis subsp. Subtilis str. 168
26% identity, 84% coverage: 46:313/318 of query aligns to 6:283/289 of 6nfpD
2ef5A Crystal structure of the arginase from thermus thermophilus
29% identity, 84% coverage: 46:313/318 of query aligns to 3:267/273 of 2ef5A
6nfpA 1.7 angstrom resolution crystal structure of arginase from bacillus subtilis subsp. Subtilis str. 168
25% identity, 84% coverage: 46:313/318 of query aligns to 3:286/292 of 6nfpA
5cevA Arginase from bacillus caldevelox, l-lysine complex (see paper)
26% identity, 83% coverage: 46:309/318 of query aligns to 3:288/298 of 5cevA
4cevA Arginase from bacillus caldevelox, l-ornithine complex (see paper)
26% identity, 83% coverage: 46:309/318 of query aligns to 3:288/298 of 4cevA
3cevA Arginase from bacillus caldevelox, complexed with l-arginine (see paper)
26% identity, 83% coverage: 46:309/318 of query aligns to 3:288/298 of 3cevA
Sites not aligning to the query:
2cevB Arginase from bacillus caldevelox, native structure at ph 8.5 (see paper)
26% identity, 83% coverage: 46:309/318 of query aligns to 3:288/298 of 2cevB
1cevA Arginase from bacillus caldovelox, native structure at ph 5.6 (see paper)
26% identity, 83% coverage: 46:309/318 of query aligns to 4:289/299 of 1cevA
P53608 Arginase; EC 3.5.3.1 from Bacillus caldovelox (see paper)
26% identity, 83% coverage: 46:309/318 of query aligns to 4:289/299 of P53608
Q57757 Agmatinase; EC 3.5.3.11 from Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440) (Methanococcus jannaschii) (see paper)
25% identity, 78% coverage: 65:313/318 of query aligns to 53:279/284 of Q57757
7esrA Crystal structure of synechocystis sp pcc6803 guanidinium hydrolase (r32) (see paper)
22% identity, 89% coverage: 28:309/318 of query aligns to 57:346/378 of 7esrA
4dz4B X-ray crystal structure of a hypothetical agmatinase from burkholderia thailandensis (see paper)
27% identity, 81% coverage: 63:318/318 of query aligns to 62:316/323 of 4dz4B
6nbkA Crystal structure of arginase from bacillus cereus
24% identity, 83% coverage: 45:309/318 of query aligns to 2:279/289 of 6nbkA
1gq6B Proclavaminate amidino hydrolase from streptomyces clavuligerus (see paper)
25% identity, 82% coverage: 38:297/318 of query aligns to 16:277/301 of 1gq6B
>BWI76_RS08725 FitnessBrowser__Koxy:BWI76_RS08725
MKLWQPTPAALWQGRDDSAEAANALRLFQTIVRAERFEPEMLAGDIALLGFACDEGVRRN
KGRTGAERGPETLRRALANMASHDGHDRCVDMGTIHVADDALEAAQQALREAVTACQRAG
KRTLVLGGGHETAFGHGAGVLDAFPGEEVGIINLDAHLDLRIADRASSGTPFRQLALACE
AQRRAFHYACIGVSRAANTQALLDEAARRGVTIIEDLDVLNAFEARAIPELARNIARYDR
LYLTIDLDVLPAREMPAVSAPAALGIPLATLLRIVEPLCRSGKLQAVDLVEFNPQYDIDS
QGARAAARLAWQIAHWWQ
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory