Comparing BWI76_RS08840 FitnessBrowser__Koxy:BWI76_RS08840 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 1 hits to proteins with known functional sites (download)
P0AAC6 Modulator of FtsH protease YccA from Escherichia coli (strain K12) (see 2 papers)
26% identity, 47% coverage: 122:231/234 of query aligns to 116:214/219 of P0AAC6
Sites not aligning to the query:
>BWI76_RS08840 FitnessBrowser__Koxy:BWI76_RS08840
MDRYPRSGAIVQGRSGLQTYMAQVYGWMTVGLLLTAFIAWFAANTPAVMMFVFSSKITFF
GLIIAQLGLVFVLSGMVQRLSAGMATTLFMLYSALTGLTLSSIFIVYTYSSIASTFVVAG
GMFGAMSLYGYTTKRDLSGFGNMLFMALIGILLASLVNFWLKSEALMWAVTYIGVIVFVG
LTAYDTQKLKNIGEQIDVRDASTLRKYSILGALTLYLDFINLFLMLLRIFGNRR
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory