SitesBLAST
Comparing BWI76_RS08965 FitnessBrowser__Koxy:BWI76_RS08965 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
4ymuJ Crystal structure of an amino acid abc transporter complex with arginines and atps (see paper)
59% identity, 100% coverage: 1:239/240 of query aligns to 1:239/240 of 4ymuJ
- binding adenosine-5'-triphosphate: F11 (= F11), V16 (= V16), S36 (= S36), G37 (= G37), S38 (= S38), G39 (= G39), K40 (= K40), S41 (= S41), T42 (= T42), E162 (= E162), H194 (= H194)
- binding magnesium ion: S41 (= S41), E162 (= E162)
4u00A Crystal structure of ttha1159 in complex with adp (see paper)
59% identity, 100% coverage: 1:239/240 of query aligns to 2:239/241 of 4u00A
3c4jA Abc protein artp in complex with atp-gamma-s
54% identity, 100% coverage: 1:239/240 of query aligns to 3:241/242 of 3c4jA
3c41J Abc protein artp in complex with amp-pnp/mg2+
54% identity, 100% coverage: 1:239/240 of query aligns to 3:241/242 of 3c41J
2olkA Abc protein artp in complex with adp-beta-s
54% identity, 100% coverage: 1:239/240 of query aligns to 3:241/242 of 2olkA
2oljA Abc protein artp in complex with adp/mg2+
54% identity, 100% coverage: 1:239/240 of query aligns to 3:241/242 of 2oljA
P02915 Histidine/lysine/arginine/ornithine transport ATP-binding protein HisP; EC 7.4.2.1 from Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) (see paper)
53% identity, 97% coverage: 6:237/240 of query aligns to 11:254/258 of P02915
- S41 (= S36) binding ATP
- G42 (= G37) binding ATP
- G44 (= G39) binding ATP
- K45 (= K40) binding ATP
- S46 (= S41) binding ATP
- T47 (= T42) binding ATP
1b0uA Atp-binding subunit of the histidine permease from salmonella typhimurium (see paper)
53% identity, 97% coverage: 6:237/240 of query aligns to 7:250/258 of 1b0uA
5xu1B Structure of a non-canonical abc transporter from streptococcus pneumoniae r6 (see paper)
45% identity, 90% coverage: 1:217/240 of query aligns to 3:223/226 of 5xu1B
P19566 Maltose/maltodextrin import ATP-binding protein MalK; EC 7.5.2.1 from Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) (see paper)
43% identity, 94% coverage: 2:227/240 of query aligns to 4:225/369 of P19566
- L86 (= L88) mutation to F: Loss of transport. No effect on ATP-binding activity but decrease in ATP hydrolysis. Retains repressor activity.
- P160 (= P163) mutation to L: Loss of transport. No effect on ATP-binding activity but decrease in ATP hydrolysis. Retains repressor activity.
- D165 (= D168) mutation to N: Loss of transport. No effect on ATP-binding activity but decrease in ATP hydrolysis. Retains repressor activity.
Sites not aligning to the query:
- 306 E→K: Loss of transport. No effect on ATP-binding and ATP hydrolysis. Retains repressor activity.
P68187 Maltose/maltodextrin import ATP-binding protein MalK; EC 7.5.2.1 from Escherichia coli (strain K12) (see 5 papers)
43% identity, 94% coverage: 2:227/240 of query aligns to 4:225/371 of P68187
- A85 (≠ Y87) mutation to M: Suppressor of EAA loop mutations in MalFG.
- K106 (≠ N109) mutation to C: Suppressor of EAA loop mutations in MalFG.
- V114 (≠ A117) mutation to C: Suppressor of EAA loop mutations in MalFG.
- V117 (≠ L120) mutation to M: Suppressor of EAA loop mutations in MalFG.
- E119 (= E122) mutation to K: Resistant to inhibitory effects of alpha-methylglucoside but retains transport capacity.
- A124 (= A127) mutation to T: Resistant to inhibitory effects of alpha-methylglucoside but retains transport capacity.
- G137 (= G140) mutation to A: Loss of maltose transport. Has greater ability to decrease mal gene expression than wild-type MalK.
- D158 (= D161) mutation to N: Loss of maltose transport but retains ability to repress mal genes.
Sites not aligning to the query:
- 228 R→C: Resistant to inhibitory effects of alpha-methylglucoside but retains transport capacity.
- 241 F→I: Resistant to inhibitory effects of alpha-methylglucoside but retains transport capacity.
- 267 W→G: Normal maltose transport but constitutive mal gene expression.
- 278 G→P: Resistant to inhibitory effects of alpha-methylglucoside but retains transport capacity.
- 282 S→L: Resistant to inhibitory effects of alpha-methylglucoside but retains transport capacity.
- 284 G→S: Resistant to inhibitory effects of alpha-methylglucoside but retains transport capacity.
- 302 G→D: Resistant to inhibitory effects of alpha-methylglucoside but retains transport capacity.
- 308 E→Q: Maltose transport is affected but retains ability to interact with MalT.
- 322 S→F: Resistant to inhibitory effects of alpha-methylglucoside but retains transport capacity.
- 340 G→A: Maltose transport is affected but retains ability to interact with MalT.
- 346 G→S: Normal maltose transport but constitutive mal gene expression.
- 355 F→Y: Maltose transport is affected but retains ability to interact with MalT.
2awnB Crystal structure of the adp-mg-bound e. Coli malk (crystallized with atp-mg) (see paper)
43% identity, 94% coverage: 2:227/240 of query aligns to 3:224/374 of 2awnB
3puyA Crystal structure of an outward-facing mbp-maltose transporter complex bound to amp-pnp after crystal soaking of the pretranslocation state (see paper)
43% identity, 94% coverage: 2:227/240 of query aligns to 3:224/371 of 3puyA
- binding phosphoaminophosphonic acid-adenylate ester: W12 (≠ F11), S37 (= S36), G38 (= G37), C39 (≠ S38), G40 (= G39), K41 (= K40), S42 (= S41), T43 (= T42), Q81 (= Q84), R128 (≠ H132), A132 (≠ E136), S134 (= S138), G136 (= G140), Q137 (= Q141), E158 (= E162), H191 (= H194)
- binding magnesium ion: S42 (= S41), Q81 (= Q84)
3puxA Crystal structure of an outward-facing mbp-maltose transporter complex bound to adp-bef3 (see paper)
43% identity, 94% coverage: 2:227/240 of query aligns to 3:224/371 of 3puxA
- binding adenosine-5'-diphosphate: W12 (≠ F11), G38 (= G37), C39 (≠ S38), G40 (= G39), K41 (= K40), S42 (= S41), T43 (= T42), R128 (≠ H132), S134 (= S138), Q137 (= Q141)
- binding beryllium trifluoride ion: S37 (= S36), G38 (= G37), K41 (= K40), Q81 (= Q84), S134 (= S138), G136 (= G140), H191 (= H194)
- binding magnesium ion: S42 (= S41), Q81 (= Q84)
3puwA Crystal structure of an outward-facing mbp-maltose transporter complex bound to adp-alf4 (see paper)
43% identity, 94% coverage: 2:227/240 of query aligns to 3:224/371 of 3puwA
- binding adenosine-5'-diphosphate: W12 (≠ F11), V17 (= V16), G38 (= G37), C39 (≠ S38), G40 (= G39), K41 (= K40), S42 (= S41), T43 (= T42), R128 (≠ H132), A132 (≠ E136), S134 (= S138), Q137 (= Q141)
- binding tetrafluoroaluminate ion: S37 (= S36), G38 (= G37), K41 (= K40), Q81 (= Q84), S134 (= S138), G135 (= G139), G136 (= G140), E158 (= E162), H191 (= H194)
- binding magnesium ion: S42 (= S41), Q81 (= Q84)
3puvA Crystal structure of an outward-facing mbp-maltose transporter complex bound to adp-vo4 (see paper)
43% identity, 94% coverage: 2:227/240 of query aligns to 3:224/371 of 3puvA
- binding adenosine-5'-diphosphate: W12 (≠ F11), V17 (= V16), G38 (= G37), C39 (≠ S38), G40 (= G39), K41 (= K40), S42 (= S41), T43 (= T42), R128 (≠ H132), A132 (≠ E136), S134 (= S138), Q137 (= Q141)
- binding magnesium ion: S42 (= S41), Q81 (= Q84)
1q12A Crystal structure of the atp-bound e. Coli malk (see paper)
43% identity, 94% coverage: 2:227/240 of query aligns to 1:222/367 of 1q12A
- binding adenosine-5'-triphosphate: W10 (≠ F11), S35 (= S36), G36 (= G37), C37 (≠ S38), G38 (= G39), K39 (= K40), S40 (= S41), T41 (= T42), R126 (≠ H132), A130 (≠ E136), S132 (= S138), G134 (= G140), Q135 (= Q141)
1f3oA Crystal structure of mj0796 atp-binding cassette (see paper)
45% identity, 89% coverage: 1:214/240 of query aligns to 1:223/232 of 1f3oA
1l2tA Dimeric structure of mj0796, a bacterial abc transporter cassette (see paper)
44% identity, 89% coverage: 1:214/240 of query aligns to 1:223/230 of 1l2tA
- binding adenosine-5'-triphosphate: Y11 (≠ F11), S40 (= S36), G41 (= G37), S42 (= S38), G43 (= G39), K44 (= K40), S45 (= S41), T46 (= T42), F138 (vs. gap), Q145 (≠ E136), S147 (= S138), G149 (= G140), Q150 (= Q141), H204 (= H194)
P30750 Methionine import ATP-binding protein MetN; EC 7.4.2.11 from Escherichia coli (strain K12) (see 3 papers)
37% identity, 99% coverage: 1:237/240 of query aligns to 1:242/343 of P30750
- 40:46 (vs. 36:42, 86% identical) binding ATP
- E166 (= E162) mutation to Q: Exhibits little ATPase activity.
Sites not aligning to the query:
- 278:283 binding L-methionine
- 295 N→A: Reduces the binding of L-methionine to undetectable levels.
- 295:296 binding L-methionine
Query Sequence
>BWI76_RS08965 FitnessBrowser__Koxy:BWI76_RS08965
MIEFKNVSKHFGPTKVLHDIDLKINQGEVVVIIGPSGSGKSTLLRCINKLEEITSGDLIV
DGLKVNDPKVDERLIRQEAGMVFQQFYLFPHLTALENVMFGPLRVRGANKAAAEKLAKDL
LEKVGLAERAHHYPSELSGGQQQRVAIARALAVKPKMMLFDEPTSALDPELRHEVLKVMQ
DLAEEGMTMVIVTHEIGFAEKVASRLIFIDKGRIAEDGDPQVLVNNPPSPRLREFLQHVA
Or try a new SitesBLAST search
SitesBLAST's Database
SitesBLAST's database includes
(1) SwissProt
entries with experimentally-supported functional features;
and (2) protein structures with bound ligands, from the
BioLip database.
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory