SitesBLAST
Comparing BWI76_RS09050 FitnessBrowser__Koxy:BWI76_RS09050 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 7 hits to proteins with known functional sites (download)
P0AA76 D-galactonate transporter; D-galactonate/H(+) symporter from Escherichia coli (strain K12) (see paper)
25% identity, 94% coverage: 22:429/433 of query aligns to 14:427/430 of P0AA76
- Y29 (= Y37) binding
- D31 (≠ T39) mutation to N: Loss of galactonate transport activity.
- R32 (= R40) binding
- Y64 (= Y72) binding
- E118 (= E126) mutation to Q: Loss of galactonate transport activity.
- W358 (≠ L359) binding
6e9nA E. Coli d-galactonate:proton symporter in the inward open form (see paper)
25% identity, 94% coverage: 22:429/433 of query aligns to 3:408/409 of 6e9nA
6e9oA E. Coli d-galactonate:proton symporter mutant e133q in the outward substrate-bound form (see paper)
24% identity, 94% coverage: 22:429/433 of query aligns to 6:392/393 of 6e9oA
Q9NRA2 Sialin; H(+)/nitrate cotransporter; H(+)/sialic acid cotransporter; AST; Membrane glycoprotein HP59; Solute carrier family 17 member 5; Vesicular excitatory amino acid transporter; VEAT from Homo sapiens (Human) (see 8 papers)
25% identity, 55% coverage: 59:297/433 of query aligns to 106:346/495 of Q9NRA2
- K136 (= K89) to E: in SD; alters intracellular localization, only partially targeted to lysosomes and mainly detected in LAMP1-negative vesicles and in the Golgi apparatus; completely devoid of L-aspartate and L-glutamate transporter activity, but retains appreciable H(+)-coupled sialic acid transporter activity; dbSNP:rs80338795
- H183 (≠ A134) to R: in ISSD; alters intracellular localization, only partially targeted to lysosomes and mainly detected in LAMP1-negative vesicles and in the Golgi apparatus; abolishes H(+)-coupled sialic acid transporter activity; has normal L-aspartate and L-glutamate transporter activity; dbSNP:rs119491109
- LL 198:199 (≠ AA 149:150) mutation to AA: Localizes in vesicular structures mainly concentrated in the perinuclear region.
- IL 266:267 (≠ I- 216) mutation to LA: Localizes in vesicular structures mainly concentrated in the perinuclear region.
- SSLRN 268:272 (≠ --QQD 217:219) natural variant: Missing (in ISSD; alters intracellular localization, only partially targeted to lysosomes and mainly detected in LAMP1-negative vesicles and in the Golgi apparatus; abolishes H(+)-coupled sialic acid transporter activity; has normal L-aspartate and L-glutamate transporter activity)
- G328 (≠ A279) to E: in ISSD; some patients may manifest a milder phenotype consistent with Salla disease; markedly decreases H(+)-coupled sialic acid transporter activity; abolishes L-aspartate and L-glutamate transporter activity; dbSNP:rs386833996
- P334 (= P285) to R: in ISSD; does not affect intracellular localization, targeted to lysosomes; abolishes H(+)-coupled sialic acid transporter activity; abolishes L-aspartate and L-glutamate transporter activity; dbSNP:rs119491110
Sites not aligning to the query:
- 22:23 Dileucine internalization motif; LL→AA: Targeted to plasma membrane.; LL→GG: Targeted to plasma membrane; sialic acid uptake strongly activated at acidic pH.
- 39 R → C: in SD; frequent variant in Finland; alters intracellular localization, only partially targeted to lysosomes and mainly detected in LAMP1-negative vesicles and in the Golgi apparatus; completely devoid of L-aspartate and L-glutamate transport activity, but retains appreciable H(+)-coupled sialic acid and nitrate transporter activity; dbSNP:rs80338794
- 371 G → V: in ISSD; abolishes H(+)-coupled sialic acid transporter activity; abolishes L-aspartate and L-glutamate transporter activity; dbSNP:rs777862172
Q9JI12 Vesicular glutamate transporter 2; VGluT2; Differentiation-associated BNPI; Differentiation-associated Na(+)-dependent inorganic phosphate cotransporter; Solute carrier family 17 member 6 from Rattus norvegicus (Rat) (see 2 papers)
24% identity, 39% coverage: 118:287/433 of query aligns to 183:357/582 of Q9JI12
- R184 (= R119) mutation R->A,E,K: Greatly lowers L-glutamate transport.
- E191 (= E126) mutation to A: Greatly lowers L-glutamate transport.; mutation E->D,Q: Lowers L-glutamate transport.
- R322 (≠ A252) mutation to A: Loss of L-glutamate release. Abolishes the chloride ion conductance.
Sites not aligning to the query:
- 88 R→A: Impairs synaptic transmission. Abolishes the chloride ion conductance.
- 128 H→A: Greatly lowers L-glutamate transport.
7t3nA R184q/e191q mutant of rat vesicular glutamate transporter 2 (vglut2)
23% identity, 39% coverage: 118:287/433 of query aligns to 125:299/452 of 7t3nA
Sites not aligning to the query:
Q5EXK5 3-hydroxybenzoate transporter MhbT from Klebsiella oxytoca (see paper)
25% identity, 40% coverage: 22:193/433 of query aligns to 20:191/452 of Q5EXK5
- D82 (= D84) mutation to A: Loss of activity.
Sites not aligning to the query:
- 311 V→W: Loss of activity.
- 314 D→A: Loss of activity.
Query Sequence
>BWI76_RS09050 FitnessBrowser__Koxy:BWI76_RS09050
MSQGLNNDMAVSKSRRIVKNLRWWMLVLFLLGVTVNYITRNSLGIIAPELKTSLGITTEQ
YSWIVGAFQLAYTIFQPLCGWLIDVIGLKLGFMICATLWAIACIAHAGAGSWLHLAILRF
FMGGAEAAATPANAKTLGEWFPKSERPIAAGWAGVGFSIGAMLAPPIIYFAHASFGWQGA
FMFTGALALVWVVLWWAFYHNPEKHPNLGKAELALIQQDNEAPPVKLPFFTALKTVSKNK
RFYGIAIPAFMAEPAWAVLSFWVPLYLAKEHGMDLKQIAMFAWLPFLAADLGSVASGYLT
KLYTRWFGCSRVNSVVASSVTGAFLMISLATVAITRDPYITIVLISIGGFGHQIISCMLS
ALVVESFDKGQMATVNGMRGSAAWIASFLFSLLIGVTADKIGFNPLFIAMGFFDLIGAVF
LVAFIAERRAKRA
Or try a new SitesBLAST search
SitesBLAST's Database
SitesBLAST's database includes
(1) SwissProt
entries with experimentally-supported functional features;
and (2) protein structures with bound ligands, from the
BioLip database.
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory