Comparing BWI76_RS09135 FitnessBrowser__Koxy:BWI76_RS09135 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 18 hits to proteins with known functional sites (download)
P75804 Aldose sugar dehydrogenase YliI; Asd; Soluble aldose sugar dehydrogenase YliI; EC 1.1.5.- from Escherichia coli (strain K12) (see paper)
74% identity, 99% coverage: 2:368/370 of query aligns to 3:369/371 of P75804
2g8sA Crystal structure of the soluble aldose sugar dehydrogenase (asd) from escherichia coli in the apo-form (see paper)
77% identity, 94% coverage: 22:368/370 of query aligns to 1:347/348 of 2g8sA
7cdyA Crystal structure of glucose dehydrogenase
72% identity, 92% coverage: 26:366/370 of query aligns to 3:343/346 of 7cdyA
7cgzA Glucose dehydrogenase
67% identity, 92% coverage: 26:366/370 of query aligns to 3:318/321 of 7cgzA
2ismB Crystal structure of the putative oxidoreductase (glucose dehydrogenase) (ttha0570) from thermus theromophilus hb8
35% identity, 93% coverage: 25:369/370 of query aligns to 3:325/333 of 2ismB
3a9hA Crystal structure of pqq-dependent sugar dehydrogenase holo-form (see paper)
33% identity, 91% coverage: 25:361/370 of query aligns to 5:319/338 of 3a9hA
Sites not aligning to the query:
3a9gA Crystal structure of pqq-dependent sugar dehydrogenase apo-form (see paper)
33% identity, 91% coverage: 25:361/370 of query aligns to 5:319/338 of 3a9gA
3dasA Structure of the pqq-bound form of aldose sugar dehydrogenase (adh) from streptomyces coelicolor
33% identity, 73% coverage: 22:292/370 of query aligns to 4:267/334 of 3dasA
Sites not aligning to the query:
1cq1A Soluble quinoprotein glucose dehydrogenase from acinetobacter calcoaceticus in complex with pqqh2 and glucose (see paper)
26% identity, 90% coverage: 27:359/370 of query aligns to 20:420/444 of 1cq1A
1c9uA Crystal structure of the soluble quinoprotein glucose dehydrogenase in complex with pqq (see paper)
26% identity, 90% coverage: 27:359/370 of query aligns to 20:420/444 of 1c9uA
5minB Apo form of the soluble pqq-dependent glucose dehydrogenase from acinetobacter calcoaceticus
27% identity, 90% coverage: 27:359/370 of query aligns to 20:426/453 of 5minB
P13650 Quinoprotein glucose dehydrogenase B; Glucose dehydrogenase B [pyrroloquinoline-quinone]; Soluble glucose dehydrogenase; s-GDH; EC 1.1.5.2 from Acinetobacter calcoaceticus (see paper)
26% identity, 97% coverage: 1:359/370 of query aligns to 11:450/478 of P13650
1cruA Soluble quinoprotein glucose dehydrogenase from acinetobacter calcoaceticus in complex with pqq and methylhydrazine (see paper)
26% identity, 90% coverage: 27:359/370 of query aligns to 20:424/448 of 1cruA
7pgnB Hhp-c in complex with glycosaminoglycan mimic sos (see paper)
26% identity, 45% coverage: 83:249/370 of query aligns to 70:242/438 of 7pgnB
Sites not aligning to the query:
7pgmB Hhip-c in complex with heparin (see paper)
27% identity, 38% coverage: 83:221/370 of query aligns to 70:213/427 of 7pgmB
Sites not aligning to the query:
7pgnA Hhp-c in complex with glycosaminoglycan mimic sos (see paper)
26% identity, 38% coverage: 83:221/370 of query aligns to 71:219/437 of 7pgnA
Sites not aligning to the query:
2wfxB Crystal structure of the complex between human hedgehog-interacting protein hip and sonic hedgehog in the presence of calcium (see paper)
24% identity, 44% coverage: 70:230/370 of query aligns to 54:222/417 of 2wfxB
Sites not aligning to the query:
Q96QV1 Hedgehog-interacting protein; HHIP; HIP from Homo sapiens (Human) (see 3 papers)
24% identity, 40% coverage: 83:230/370 of query aligns to 283:447/700 of Q96QV1
>BWI76_RS09135 FitnessBrowser__Koxy:BWI76_RS09135
MRQTINLIALTALLLPTASLAAQERVEVLQNQLEHPWALAFLPDDRGILMTLRGGELRLW
QRDKGLAPAISGVPQVWANGQGGLLDVALAPDFAQSRRVWLSYAEGGSDGKAGTAVGYGR
LSDDLQRLENFQVVFRQQPKLSTGNHFGGRLVFDGRGYLFIGLGENNQRSTAQDLDKLQG
KVVRLTADGKVPDDNPFVGQAGVRPEIWSYGIRNPQGMAMNPWSDTLWLNEHGPRGGDEI
NIPQKGKNYGWPLATHGINYSGLPIPEAKGKTAEGTEAPLFVWEKSPAVSGMAFYDAQTF
PQWRHRLFIGALKDKSLIVLKVDGDNVTEQERILGDRGKRIRDVRVGPDGYLYVLTDESN
GELLKVRPAG
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory