SitesBLAST
Comparing BWI76_RS09465 FitnessBrowser__Koxy:BWI76_RS09465 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
P69874 Spermidine/putrescine import ATP-binding protein PotA; EC 7.6.2.11 from Escherichia coli (strain K12) (see 3 papers)
46% identity, 85% coverage: 26:357/392 of query aligns to 9:339/378 of P69874
- C26 (≠ S43) mutation to A: Lower ATPase activity and transport efficiency.
- F27 (= F44) mutation to L: Lower ATPase activity and transport efficiency.
- F45 (≠ I62) mutation to L: Lower ATPase activity and transport efficiency.
- C54 (= C71) mutation to T: Loss of ATPase activity and transport.
- L60 (= L77) mutation to F: Lower ATPase activity and transport efficiency.
- L76 (= L93) mutation to P: Lower ATPase activity and transport efficiency.
- V135 (= V152) mutation to M: Loss of ATPase activity and transport.
- D172 (= D189) mutation to N: Loss of ATPase activity and transport.
- C276 (≠ H292) mutation to A: Lower ATPase activity and transport efficiency.
- E297 (= E315) mutation E->K,D: Lower ATPase activity and transport efficiency.; mutation to Q: Loss of ATPase activity and transport.
2d62A Crystal structure of multiple sugar binding transport atp- binding protein
41% identity, 88% coverage: 39:383/392 of query aligns to 11:359/375 of 2d62A
1g291 Malk (see paper)
41% identity, 88% coverage: 39:383/392 of query aligns to 8:356/372 of 1g291
- binding magnesium ion: D69 (≠ R100), E71 (vs. gap), K72 (vs. gap), K79 (≠ Y104), D80 (≠ Q105), E292 (= E315), D293 (≠ K316)
- binding pyrophosphate 2-: S38 (= S69), G39 (= G70), C40 (= C71), G41 (= G72), K42 (= K73), T43 (≠ S74), T44 (= T75)
Sites not aligning to the query:
1vciA Crystal structure of the atp-binding cassette of multisugar transporter from pyrococcus horikoshii ot3 complexed with atp (see paper)
43% identity, 81% coverage: 35:351/392 of query aligns to 7:311/353 of 1vciA
8hprD Lpqy-sugabc in state 4 (see paper)
49% identity, 59% coverage: 40:271/392 of query aligns to 8:242/362 of 8hprD
- binding adenosine-5'-triphosphate: Y12 (≠ F44), S38 (= S69), C40 (= C71), G41 (= G72), K42 (= K73), S43 (= S74), T44 (= T75), Q82 (= Q113), R129 (= R160), Q133 (= Q164), S135 (= S166), G136 (= G167), G137 (= G168), Q159 (≠ E190), H192 (= H223)
- binding magnesium ion: S43 (= S74), Q82 (= Q113)
8hprC Lpqy-sugabc in state 4 (see paper)
49% identity, 59% coverage: 40:271/392 of query aligns to 8:242/363 of 8hprC
- binding adenosine-5'-triphosphate: Y12 (≠ F44), S38 (= S69), G39 (= G70), G41 (= G72), K42 (= K73), S43 (= S74), Q82 (= Q113), Q133 (= Q164), G136 (= G167), G137 (= G168), Q138 (= Q169), H192 (= H223)
- binding magnesium ion: S43 (= S74), Q82 (= Q113)
8hplC Lpqy-sugabc in state 1 (see paper)
48% identity, 59% coverage: 40:271/392 of query aligns to 8:240/384 of 8hplC
P9WQI3 Trehalose import ATP-binding protein SugC; MtbSugC; Nucleotide-binding domain of SugABC transporter; NBD of SugABC transporter; SugABC transporter ATPase SugC; EC 7.5.2.- from Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) (see paper)
49% identity, 59% coverage: 39:271/392 of query aligns to 8:243/393 of P9WQI3
- H193 (= H223) mutation to A: Decreased hydrolysis of ATP. No change in KM, but 2-fold reduction in Vmax compared to wild-type.
P19566 Maltose/maltodextrin import ATP-binding protein MalK; EC 7.5.2.1 from Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) (see paper)
44% identity, 59% coverage: 35:267/392 of query aligns to 4:236/369 of P19566
- L86 (= L117) mutation to F: Loss of transport. No effect on ATP-binding activity but decrease in ATP hydrolysis. Retains repressor activity.
- P160 (= P191) mutation to L: Loss of transport. No effect on ATP-binding activity but decrease in ATP hydrolysis. Retains repressor activity.
- D165 (= D196) mutation to N: Loss of transport. No effect on ATP-binding activity but decrease in ATP hydrolysis. Retains repressor activity.
Sites not aligning to the query:
- 306 E→K: Loss of transport. No effect on ATP-binding and ATP hydrolysis. Retains repressor activity.
1oxvD Crystal structure of glcv, the abc-atpase of the glucose abc transporter from sulfolobus solfataricus (see paper)
38% identity, 79% coverage: 37:344/392 of query aligns to 6:310/353 of 1oxvD
1oxvA Crystal structure of glcv, the abc-atpase of the glucose abc transporter from sulfolobus solfataricus (see paper)
38% identity, 79% coverage: 37:344/392 of query aligns to 6:310/353 of 1oxvA
1oxuA Crystal structure of glcv, the abc-atpase of the glucose abc transporter from sulfolobus solfataricus (see paper)
38% identity, 79% coverage: 37:344/392 of query aligns to 6:310/353 of 1oxuA
Q97UY8 Glucose import ATP-binding protein GlcV; EC 7.5.2.- from Saccharolobus solfataricus (strain ATCC 35092 / DSM 1617 / JCM 11322 / P2) (Sulfolobus solfataricus) (see paper)
38% identity, 79% coverage: 37:344/392 of query aligns to 6:310/353 of Q97UY8
- S142 (= S166) mutation to A: Decrease in ATPase activity. Can form dimers.
- G144 (= G168) mutation to A: Loss of ATPase activity. Cannot form dimers. Forms an active heterodimer; when associated with A-166.
- E166 (= E190) mutation to A: Loss of ATPase activity. Can form dimers in the presence of ATP-Mg(2+). Forms an active heterodimer; when associated with A-144.; mutation to Q: Strong decrease in ATPase activity. Can form dimers in the presence of ATP alone, without Mg(2+).
2awnB Crystal structure of the adp-mg-bound e. Coli malk (crystallized with atp-mg) (see paper)
44% identity, 59% coverage: 35:267/392 of query aligns to 3:235/374 of 2awnB
3puyA Crystal structure of an outward-facing mbp-maltose transporter complex bound to amp-pnp after crystal soaking of the pretranslocation state (see paper)
44% identity, 59% coverage: 35:267/392 of query aligns to 3:235/371 of 3puyA
- binding phosphoaminophosphonic acid-adenylate ester: W12 (≠ F44), S37 (= S69), G38 (= G70), C39 (= C71), G40 (= G72), K41 (= K73), S42 (= S74), T43 (= T75), Q81 (= Q113), R128 (= R160), A132 (≠ Q164), S134 (= S166), G136 (= G168), Q137 (= Q169), E158 (= E190), H191 (= H223)
- binding magnesium ion: S42 (= S74), Q81 (= Q113)
3puxA Crystal structure of an outward-facing mbp-maltose transporter complex bound to adp-bef3 (see paper)
44% identity, 59% coverage: 35:267/392 of query aligns to 3:235/371 of 3puxA
- binding adenosine-5'-diphosphate: W12 (≠ F44), G38 (= G70), C39 (= C71), G40 (= G72), K41 (= K73), S42 (= S74), T43 (= T75), R128 (= R160), S134 (= S166), Q137 (= Q169)
- binding beryllium trifluoride ion: S37 (= S69), G38 (= G70), K41 (= K73), Q81 (= Q113), S134 (= S166), G136 (= G168), H191 (= H223)
- binding magnesium ion: S42 (= S74), Q81 (= Q113)
3puwA Crystal structure of an outward-facing mbp-maltose transporter complex bound to adp-alf4 (see paper)
44% identity, 59% coverage: 35:267/392 of query aligns to 3:235/371 of 3puwA
- binding adenosine-5'-diphosphate: W12 (≠ F44), V17 (≠ A49), G38 (= G70), C39 (= C71), G40 (= G72), K41 (= K73), S42 (= S74), T43 (= T75), R128 (= R160), A132 (≠ Q164), S134 (= S166), Q137 (= Q169)
- binding tetrafluoroaluminate ion: S37 (= S69), G38 (= G70), K41 (= K73), Q81 (= Q113), S134 (= S166), G135 (= G167), G136 (= G168), E158 (= E190), H191 (= H223)
- binding magnesium ion: S42 (= S74), Q81 (= Q113)
3puvA Crystal structure of an outward-facing mbp-maltose transporter complex bound to adp-vo4 (see paper)
44% identity, 59% coverage: 35:267/392 of query aligns to 3:235/371 of 3puvA
- binding adenosine-5'-diphosphate: W12 (≠ F44), V17 (≠ A49), G38 (= G70), C39 (= C71), G40 (= G72), K41 (= K73), S42 (= S74), T43 (= T75), R128 (= R160), A132 (≠ Q164), S134 (= S166), Q137 (= Q169)
- binding magnesium ion: S42 (= S74), Q81 (= Q113)
P68187 Maltose/maltodextrin import ATP-binding protein MalK; EC 7.5.2.1 from Escherichia coli (strain K12) (see 5 papers)
44% identity, 59% coverage: 35:267/392 of query aligns to 4:236/371 of P68187
- A85 (= A116) mutation to M: Suppressor of EAA loop mutations in MalFG.
- K106 (≠ P137) mutation to C: Suppressor of EAA loop mutations in MalFG.
- V114 (= V145) mutation to C: Suppressor of EAA loop mutations in MalFG.
- V117 (≠ M148) mutation to M: Suppressor of EAA loop mutations in MalFG.
- E119 (≠ A150) mutation to K: Resistant to inhibitory effects of alpha-methylglucoside but retains transport capacity.
- A124 (≠ Q155) mutation to T: Resistant to inhibitory effects of alpha-methylglucoside but retains transport capacity.
- G137 (= G168) mutation to A: Loss of maltose transport. Has greater ability to decrease mal gene expression than wild-type MalK.
- D158 (= D189) mutation to N: Loss of maltose transport but retains ability to repress mal genes.
- R228 (= R259) mutation to C: Resistant to inhibitory effects of alpha-methylglucoside but retains transport capacity.
Sites not aligning to the query:
- 241 F→I: Resistant to inhibitory effects of alpha-methylglucoside but retains transport capacity.
- 267 W→G: Normal maltose transport but constitutive mal gene expression.
- 278 G→P: Resistant to inhibitory effects of alpha-methylglucoside but retains transport capacity.
- 282 S→L: Resistant to inhibitory effects of alpha-methylglucoside but retains transport capacity.
- 284 G→S: Resistant to inhibitory effects of alpha-methylglucoside but retains transport capacity.
- 302 G→D: Resistant to inhibitory effects of alpha-methylglucoside but retains transport capacity.
- 308 E→Q: Maltose transport is affected but retains ability to interact with MalT.
- 322 S→F: Resistant to inhibitory effects of alpha-methylglucoside but retains transport capacity.
- 340 G→A: Maltose transport is affected but retains ability to interact with MalT.
- 346 G→S: Normal maltose transport but constitutive mal gene expression.
- 355 F→Y: Maltose transport is affected but retains ability to interact with MalT.
1q12A Crystal structure of the atp-bound e. Coli malk (see paper)
44% identity, 59% coverage: 35:267/392 of query aligns to 1:233/367 of 1q12A
- binding adenosine-5'-triphosphate: W10 (≠ F44), S35 (= S69), G36 (= G70), C37 (= C71), G38 (= G72), K39 (= K73), S40 (= S74), T41 (= T75), R126 (= R160), A130 (≠ Q164), S132 (= S166), G134 (= G168), Q135 (= Q169)
Query Sequence
>BWI76_RS09465 FitnessBrowser__Koxy:BWI76_RS09465
MVRLHHDLISAGEHPVNDVIPRPQAKTPKALTPLLEIRNLTKSFDGQHAVDDVNLTIYKG
EIFALLGASGCGKSTLLRMLAGFEQPTAGQIVLDGVDLARVPPYQRPINMMFQSYALFPH
MTVEQNIAFGLKQDKLPKAEITSRVQEMLALVHMQEFAKRKPHQLSGGQRQRVALARSLA
KRPKLLLLDEPMGALDKKLRDRMQLEVVDILERVGVTCVMVTHDQEEAMTMAGRIAIMNR
GKFVQIGEPEEIYEHPTTRYSAEFIGSVNVFEGLVKERQEDGLVLDSPGLTHPLKVDPDA
SVVDNVPVWVALRPEKIMLCEDPPADGYNFAVGEVIYIAYLGDLSIYHVRLKSGQMLSAQ
LQNEHRYRKGAPTWGDEVRLCWDADSCVVLTV
Or try a new SitesBLAST search
SitesBLAST's Database
SitesBLAST's database includes
(1) SwissProt
entries with experimentally-supported functional features;
and (2) protein structures with bound ligands, from the
BioLip database.
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory