SitesBLAST
Comparing BWI76_RS10225 FitnessBrowser__Koxy:BWI76_RS10225 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
P0AGF4 D-xylose-proton symporter; D-xylose transporter from Escherichia coli (strain K12) (see paper)
34% identity, 96% coverage: 5:466/483 of query aligns to 4:484/491 of P0AGF4
- F24 (≠ L25) mutation to A: Decreases xylose transport.
- G83 (= G76) mutation to A: Abolishes xylose transport.
- R133 (= R108) mutation R->C,H,L: Abolishes xylose transport.
- E153 (= E128) mutation to A: Abolishes xylose transport.
- R160 (= R135) mutation to A: Abolishes xylose transport.
- Q168 (= Q143) binding ; mutation to A: Abolishes xylose transport.
- Q288 (= Q270) mutation to A: Abolishes xylose transport.
- QQ 288:289 (= QQ 270:271) binding
- Q289 (= Q271) mutation to A: Strongly decreases xylose transport.
- N294 (= N276) binding ; mutation to A: Abolishes xylose transport.
- Y298 (= Y280) mutation to A: Abolishes xylose transport.
- N325 (≠ L307) mutation to A: No effect on xylose transport.
- G340 (= G322) mutation to A: Abolishes xylose transport.
- R341 (= R323) mutation R->A,W: Abolishes xylose transport.
- W392 (= W374) binding ; mutation to A: Abolishes xylose transport.
- E397 (= E379) mutation to A: Abolishes xylose transport.
- R404 (= R386) mutation to A: Strongly decreases xylose transport.
- Q415 (≠ M397) binding
- W416 (= W398) mutation to A: Strongly decreases xylose transport.
4gc0A The structure of the mfs (major facilitator superfamily) proton:xylose symporter xyle bound to 6-bromo-6-deoxy-d-glucose (see paper)
35% identity, 94% coverage: 7:459/483 of query aligns to 2:473/475 of 4gc0A
4gbzA The structure of the mfs (major facilitator superfamily) proton:xylose symporter xyle bound to d-glucose (see paper)
35% identity, 94% coverage: 7:459/483 of query aligns to 2:473/475 of 4gbzA
4gbyA The structure of the mfs (major facilitator superfamily) proton:xylose symporter xyle bound to d-xylose (see paper)
35% identity, 94% coverage: 7:459/483 of query aligns to 2:473/475 of 4gbyA
A0A0H2VG78 Glucose transporter GlcP; Glucose/H(+) symporter from Staphylococcus epidermidis (strain ATCC 12228 / FDA PCI 1200) (see paper)
31% identity, 93% coverage: 10:457/483 of query aligns to 6:434/446 of A0A0H2VG78
- D22 (= D28) mutation to N: Affects symport activity. May function as an uniporter.
- R102 (= R108) mutation to A: Loss of transport activity.
- I105 (≠ G111) mutation to S: Affects symport activity. May function as an uniporter.
- E122 (= E128) mutation to A: Loss of transport activity.
- Q137 (= Q143) mutation to A: Loss of transport activity.
- Q250 (= Q270) mutation to A: Loss of transport activity.
- Q251 (= Q271) mutation to A: Loss of transport activity.
- N256 (= N276) mutation to A: Loss of transport activity.
- W357 (= W374) mutation to A: Loss of transport activity.
Q8VZR6 Inositol transporter 1 from Arabidopsis thaliana (Mouse-ear cress) (see paper)
29% identity, 95% coverage: 10:469/483 of query aligns to 30:486/509 of Q8VZR6
- ER 481:482 (≠ SR 464:465) mutation to AA: No effect on targeting.
Sites not aligning to the query:
- 479:509 mutation Missing: Leads to endoplasmic reticulum relocalization.
- 500:509 mutation Missing: Leads to endoplasmic reticulum relocalization.
- 502:504 mutation LLE->AAA,SSS: Leads to plasma membrane relocalization.
4zw9A Crystal structure of human glut3 bound to d-glucose in the outward- occluded conformation at 1.5 angstrom (see paper)
26% identity, 94% coverage: 1:456/483 of query aligns to 1:461/470 of 4zw9A
- binding beta-D-glucopyranose: Q159 (= Q143), I166 (≠ Q150), Q280 (= Q270), Q281 (= Q271), N286 (= N276), F377 (≠ W369), W386 (= W374)
- binding alpha-D-glucopyranose: Q159 (= Q143), I162 (≠ M146), I166 (≠ Q150), Q280 (= Q270), Q281 (= Q271), N286 (= N276), W386 (= W374)
P11169 Solute carrier family 2, facilitated glucose transporter member 3; Glucose transporter type 3, brain; GLUT-3 from Homo sapiens (Human) (see paper)
26% identity, 94% coverage: 1:456/483 of query aligns to 1:461/496 of P11169
- Q159 (= Q143) binding
- QLS 277:279 (≠ AVL 267:269) Important for selectivity against fructose; mutation to HVA: Confers moderate fructose transport activity.
- QQ 280:281 (= QQ 270:271) binding
- N286 (= N276) binding
- N315 (≠ L307) binding
- E378 (≠ S370) binding
- W386 (= W374) binding
7spsA Crystal structure of human glucose transporter glut3 bound with exofacial inhibitor sa47 (see paper)
26% identity, 94% coverage: 5:456/483 of query aligns to 1:458/468 of 7spsA
- binding methyl N-[(2-{4-[4-(5-fluoro-2-methoxyphenyl)piperazin-1-yl]-1H-pyrazolo[3,4-d]pyrimidin-1-yl}phenyl)methyl]-beta-alaninate: F21 (≠ L25), T25 (≠ A29), N29 (≠ S33), Q156 (= Q143), I163 (≠ Q150), Q278 (= Q271), F286 (≠ M279), A308 (≠ L303), N312 (≠ L307), F374 (≠ W369), E375 (≠ S370), N406 (≠ M397), W407 (= W398), N410 (= N401)
7crzA Crystal structure of human glucose transporter glut3 bound with c3361 (see paper)
26% identity, 94% coverage: 5:456/483 of query aligns to 2:459/469 of 7crzA
- binding (2S,3R,4S,5R,6R)-6-(hydroxymethyl)-4-undec-10-enoxy-oxane-2,3,5-triol: T26 (≠ A29), A66 (≠ V57), S69 (vs. gap), Q157 (= Q143), I164 (≠ Q150), Q278 (= Q270), Q279 (= Q271), N284 (= N276), N313 (≠ L307), F375 (≠ W369), W384 (= W374), N411 (= N401), F412 (= F402), G415 (≠ T405)
7sptA Crystal structure of exofacial state human glucose transporter glut3 (see paper)
26% identity, 94% coverage: 1:456/483 of query aligns to 1:461/470 of 7sptA
Q94KE0 Sugar transporter ESL1; Protein EARLY-RESPONSIVE TO DEHYDRATION 6-LIKE 1; ERD six-like 1; Sugar transporter ERD6-like 3; Sugar transporter-like protein 2 from Arabidopsis thaliana (Mouse-ear cress) (see paper)
28% identity, 90% coverage: 22:457/483 of query aligns to 47:462/470 of Q94KE0
Sites not aligning to the query:
- 10 L→A: Localizes mainly to the endoplasmic reticulum.
- 10:16 Essential for the localization to the vacuole membrane
- 14 L→A: Localizes to the plasma membrane. Loss of localization to the vacuole membrane; when associated with A-15 and A-16.
- 15 L→A: Localizes to the plasma membrane. Loss of localization to the vacuole membrane; when associated with A-14 and A-16.
- 16 L→A: Loss of localization to the vacuole membrane; when associated with A-14 and A-15.
Q9LT15 Sugar transport protein 10; AtSTP10; D-glucose-H(+) symport protein STP10; D-glucose-proton symporter STP10; Hexose transporter 10 from Arabidopsis thaliana (Mouse-ear cress) (see 2 papers)
25% identity, 93% coverage: 10:456/483 of query aligns to 24:485/514 of Q9LT15
- F39 (≠ L25) mutation to A: Reduces affinity for glucose 8-fold.
- L43 (≠ A29) mutation to A: Reduces affinity for glucose 150-fold and turns STP10 into a low affinity transporter.
- C77 (vs. gap) modified: Disulfide link with 449; mutation to A: Increases sensitivity to alkaline pH and can only function fully at acidic pH (pH < 5).
- E162 (= E128) mutation to Q: Abolishes glucose transport activity; when associated with N-344.
- Q177 (= Q143) binding ; mutation to A: Reduces affinity for glucose 37-fold.
- I184 (≠ Q150) mutation to A: Reduces affinity for glucose 3-fold.
- Q295 (= Q270) binding
- Q296 (= Q271) binding
- N301 (= N276) binding
- N332 (≠ L307) binding
- D344 (= D319) mutation to N: Abolishes glucose transport activity; when associated with Q-162.
- W410 (= W374) binding
- C449 (≠ E419) modified: Disulfide link with 77; mutation to A: Increases sensitivity to alkaline pH and can only function fully at acidic pH (pH < 5).
P17809 Solute carrier family 2, facilitated glucose transporter member 1; Glucose transporter type 1, erythrocyte/brain; GLUT-1; GT1 from Mus musculus (Mouse) (see 3 papers)
26% identity, 91% coverage: 41:480/483 of query aligns to 54:482/492 of P17809
Sites not aligning to the query:
- 45 modified: carbohydrate, N-linked (GlcNAc...) asparagine
- 485 P→L: Lethality immediately after birth in knockin mice; caused by creation of a dileucine internalization motif that promotes mislocalization of the protein.
7aaqA Sugar/h+ symporter stp10 in outward occluded conformation (see paper)
25% identity, 93% coverage: 10:456/483 of query aligns to 4:465/487 of 7aaqA
Q9C757 Probable inositol transporter 2 from Arabidopsis thaliana (Mouse-ear cress) (see paper)
29% identity, 66% coverage: 9:327/483 of query aligns to 26:344/580 of Q9C757
Sites not aligning to the query:
- 399 C→A: Strongly decreased nickel inhibition; when associated with A-402, A-410 and A-413.; C→S: No effect on inostol transport or nickel inhibition. No effect on inostol transport or nickel inhibition; when associated with S-410.
- 402 C→A: Strongly decreased nickel inhibition; when associated with A-399, A-410 and A-413.
- 410 C→A: Strongly decreased nickel inhibition; when associated with A-399, A-402 and A-413.; C→S: No effect on inostol transport or nickel inhibition; when associated with S-399.
- 413 C→A: Strongly decreased nickel inhibition; when associated with A-399, A-402 and A-410.
P11166 Solute carrier family 2, facilitated glucose transporter member 1; Glucose transporter type 1, erythrocyte/brain; GLUT-1; HepG2 glucose transporter from Homo sapiens (Human) (see 23 papers)
26% identity, 89% coverage: 52:480/483 of query aligns to 65:482/492 of P11166
- M77 (≠ I62) to T: in EIG12; decreased glucose transport; dbSNP:rs1187210267
- G91 (= G76) to D: in GLUT1DS1; significantly decreases the transport of 3-O-methyl-D-glucose; dbSNP:rs80359814
- R126 (= R108) to C: in GLUT1DS1, GLUT1DS2 and DYT9; reduced transporter activity; dbSNP:rs80359818; to H: in GLUT1DS1; significantly decreases the transport of 3-O-methyl-D-glucose and dehydroascorbic acid; 57% of wild-type glucose uptake activity; dbSNP:rs80359816
- G130 (= G112) to S: in GLUT1DS1; 75% of wild-type glucose uptake activity; dbSNP:rs80359819
- T137 (≠ S119) binding
- P149 (= P131) to A: in EIG12; uncertain significance
- R153 (= R135) to C: in GLUT1DS1; 44% of wild-type glucose uptake activity
- L169 (= L151) natural variant: Missing (in GLUT1DS1; 48% of wild-type glucose uptake activity; dbSNP:rs80359832)
- I192 (≠ S180) mutation to C: Strongly decreases glucose transport.
- L204 (≠ V192) mutation to C: Abolishes glucose transport.
- P205 (≠ F193) mutation to C: Abolishes glucose transport.
- R212 (= R200) to C: in GLUT1DS1 and DYT9; dbSNP:rs387907312
- R218 (= R205) to S: in EIG12; decreased glucose transport
- R223 (≠ K210) to P: in EIG12; mild phenotype; reduced transporter activity; impaired phosphorylation by PKC; dbSNP:rs397514564; to Q: in EIG12; uncertain significance; no effect on glucose transport; impaired phosphorylation by PKC; dbSNP:rs397514564; to W: in GLUT1DS1; impaired phosphorylation by PKC; dbSNP:rs796053248
- S226 (≠ K213) modified: Phosphoserine; by PKC/PRKCB; mutation to A: Abolishes phosphorylation by PKA, leading to impaired response to TPA.
- R232 (≠ S219) to C: in EIG12; the mutant protein is expressed at the cell surface but has mildly decreased glucose uptake (70%) compared to wild-type; dbSNP:rs387907313
- E243 (= E230) to V: in EIG12; decreased glucose transport
- A275 (≠ G263) to T: in GLUT1DS2; the mutation decreases glucose transport but does not affect cation permeability; dbSNP:rs121909740
- Q282 (= Q270) binding
- QQLS 282:285 (≠ QQVS 270:273) natural variant: Missing (in GLUT1DS2; accompanied by hemolytic anemia and altered erythrocyte ion concentrations; the mutation decreases glucose transport and causes a cation leak that alteres intracellular concentrations of sodium potassium and calcium)
- G286 (= G274) to D: in SDCHCN; no effect on protein abundance; no effect on localization to the plasma membrane; loss of D-glucose transporter activity; increased cation leakage; dbSNP:rs864309514
- T295 (≠ P283) to M: in GLUT1DS1; 75% of wild-type glucose uptake activity; dbSNP:rs80359823
- V303 (≠ T293) to L: found in a patient with GLUT1 deficiency syndrome; dbSNP:rs1205631854
- G314 (= G304) to S: in GLUT1DS2; the mutation decreases glucose transport but does not affect cation permeability; dbSNP:rs121909739
- S324 (≠ A314) to L: in GLUT1DS2; mild phenotype; reduced transporter activity; dbSNP:rs796053253
- E329 (≠ D319) to Q: in GLUT1DS1; stabilizes the inward-open conformation
- R333 (= R323) to Q: in GLUT1DS1 and GLUT1DS2; dbSNP:rs1553155986; to W: in GLUT1DS1; 43% of wild-type glucose uptake activity; dbSNP:rs80359825
- G340 (= G330) mutation to C: Strongly decreases glucose transport.
- W388 (= W374) binding
- N411 (≠ M397) Not glycosylated; binding ; to S: in EIG12; decreased glucose transport; dbSNP:rs398123069
- I435 (≠ L428) natural variant: Missing (in SDCHCN; no effect on protein abundance; no effect on localization to the plasma membrane; loss of D-glucose transporter activity; increased cation leakage)
- R458 (≠ V451) to W: in EIG12; decreased glucose transport; dbSNP:rs13306758
Sites not aligning to the query:
- 34 N → S: in GLUT1DS1; 55% of wild-type glucose uptake activity; dbSNP:rs80359812
- 45 modified: carbohydrate, N-linked (GlcNAc...) asparagine; N→T: Loss of glycosylation site.
- 51 R → H: in EIG12; uncertain significance; dbSNP:rs201815571
- 60 T → M: in EIG12; uncertain significance; decreased glucose transport; dbSNP:rs142986731
- 485 P → L: in GLUT1DS1; creates a dileucine internalization motif that promotes recruitment of clathrin and mislocalization of the protein to endocytic compartments
7aarA Sugar/h+ symporter stp10 in inward open conformation (see paper)
25% identity, 93% coverage: 10:456/483 of query aligns to 9:470/485 of 7aarA
- binding Octyl Glucose Neopentyl Glycol : L28 (≠ A29), I90 (≠ F71), H94 (≠ F75), V98 (≠ A79), F101 (≠ I82), N138 (≠ S119), P142 (= P123), N158 (≠ L139), F161 (≠ Q142), Q162 (= Q143), I165 (≠ M146), D210 (≠ E197), G391 (= G372), P392 (vs. gap), W395 (= W374), M419 (≠ W398)
- binding beta-D-glucopyranose: Q280 (= Q270), N286 (= N276), M289 (= M279), G391 (= G372), W395 (= W374)
5c65A Structure of the human glucose transporter glut3 / slc2a3
25% identity, 93% coverage: 6:456/483 of query aligns to 1:449/457 of 5c65A
- binding Octyl Glucose Neopentyl Glycol : L42 (≠ P47), L58 (vs. gap), F75 (≠ W66), S76 (≠ G67), L79 (≠ R70), R87 (≠ K78), L95 (≠ I86), L96 (= L87), L121 (≠ M109), P199 (≠ F193)
- binding cholesterol hemisuccinate: I270 (≠ C264), S396 (= S396), T399 (≠ V399)
O23492 Inositol transporter 4; Myo-inositol-proton symporter INT4; Protein INOSITOL TRANSPORTER 4 from Arabidopsis thaliana (Mouse-ear cress) (see paper)
28% identity, 70% coverage: 7:345/483 of query aligns to 23:364/582 of O23492
Sites not aligning to the query:
- 559:561 LLE→AAA: No effect on targeting.
- 559:582 mutation Missing: No effect on targeting.
- 564:565 FK→AA: No effect on targeting.
- 570:575 RRREKK→AAAAAA: No effect on targeting.
Query Sequence
>BWI76_RS10225 FitnessBrowser__Koxy:BWI76_RS10225
MSTRKRNVPYLIFICAIASVSGIILGYDASVISGVIDPLTEHLSLTPAQSGWAVSNVILG
CIVGAWGVGRFTDRFGRKATLIITAILFAISAIGSALANDLTWFVVYRMIGGLAVGMASA
VTPLYIAEVSPKDLRGRMLGMQQMLMVGGQLVVYIVNYLIARGMAHEWVVSIGWRWMLAS
ALIPCVLFLVMVFFMPESPRWYAMRNQKEKSLKVLTSLSNPGHAERLYAEIRTSIATDSA
LLSIPTPRGILRDKKSSYILWIGCAIAVLQQVSGINILMYFAPSLLQNVTGNTQDSMFQS
IFLGLALLAGVSIALVAFDRIGRLPLLRWGSLGCAAFLLFTSWAFMNEVKGYLPIVGLVG
FIFVFGMSWSLGAWLLISEIFPNRMRAVAMGYAFCSMWVSNFIVTQSFPMMNRNPVLMEH
FHGAFPLLLCSGFSIIAFWFVGRFLPETKGVSLENIEPLMLSKSRRFGREQQMLVTPESV
SQK
Or try a new SitesBLAST search
SitesBLAST's Database
SitesBLAST's database includes
(1) SwissProt
entries with experimentally-supported functional features;
and (2) protein structures with bound ligands, from the
BioLip database.
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory