Comparing BWI76_RS10270 FitnessBrowser__Koxy:BWI76_RS10270 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
7rsfA Acetylornithine deacetylase from escherichia coli
32% identity, 84% coverage: 37:365/391 of query aligns to 36:358/380 of 7rsfA
7uoiA Crystallographic structure of dape from enterococcus faecium
29% identity, 96% coverage: 9:385/391 of query aligns to 3:382/383 of 7uoiA
P44514 Succinyl-diaminopimelate desuccinylase; SDAP desuccinylase; N-succinyl-LL-2,6-diaminoheptanedioate amidohydrolase; EC 3.5.1.18 from Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd) (see 3 papers)
26% identity, 81% coverage: 71:385/391 of query aligns to 61:375/377 of P44514
5vo3A Crystal structure of dape in complex with the products (succinic acid and diaminopimelic acid) (see paper)
26% identity, 81% coverage: 71:385/391 of query aligns to 65:379/380 of 5vo3A
7lgpB Dape enzyme from shigella flexneri
26% identity, 80% coverage: 67:380/391 of query aligns to 58:371/377 of 7lgpB
4pqaA Crystal structure of succinyl-diaminopimelate desuccinylase from neisseria meningitidis mc58 in complex with the inhibitor captopril (see paper)
27% identity, 81% coverage: 68:385/391 of query aligns to 60:375/375 of 4pqaA
4o23A Crystal structure of mono-zinc form of succinyl diaminopimelate desuccinylase from neisseria meningitidis mc58 (see paper)
27% identity, 81% coverage: 68:385/391 of query aligns to 60:375/376 of 4o23A
7t1qA Crystal structure of the succinyl-diaminopimelate desuccinylase (dape) from acinetobacter baumannii in complex with succinic acid
29% identity, 57% coverage: 69:292/391 of query aligns to 59:286/377 of 7t1qA
Sites not aligning to the query:
Q8P8J5 N-acetyl-L-citrulline deacetylase; ACDase; Acetylcitrulline deacetylase; EC 3.5.1.- from Xanthomonas campestris pv. campestris (strain ATCC 33913 / DSM 3586 / NCPPB 528 / LMG 568 / P 25) (see paper)
28% identity, 90% coverage: 15:365/391 of query aligns to 12:346/366 of Q8P8J5
2f7vA Structure of acetylcitrulline deacetylase complexed with one co (see paper)
28% identity, 90% coverage: 15:365/391 of query aligns to 13:341/360 of 2f7vA
P06621 Carboxypeptidase G2; CPDG2; Folate hydrolase G2; Glutamate carboxypeptidase; Pteroylmonoglutamic acid hydrolase G2; Glucarpidase; EC 3.4.17.11 from Pseudomonas sp. (strain RS-16) (see paper)
27% identity, 71% coverage: 13:291/391 of query aligns to 45:316/415 of P06621
Sites not aligning to the query:
1cg2A Carboxypeptidase g2 (see paper)
27% identity, 71% coverage: 13:291/391 of query aligns to 20:291/389 of 1cg2A
Sites not aligning to the query:
7m6uB Crystal structure of a circular permutation and computationally designed pro-enzyme of carboxypeptidase g2 (see paper)
26% identity, 60% coverage: 59:291/391 of query aligns to 4:226/392 of 7m6uB
Sites not aligning to the query:
Q03154 Aminoacylase-1; ACY-1; N-acyl-L-amino-acid amidohydrolase; EC 3.5.1.14 from Homo sapiens (Human) (see 6 papers)
29% identity, 57% coverage: 52:275/391 of query aligns to 53:291/408 of Q03154
Sites not aligning to the query:
5xoyA Crystal structure of lysk from thermus thermophilus in complex with lysine (see paper)
28% identity, 90% coverage: 20:371/391 of query aligns to 10:324/341 of 5xoyA
1lfwA Crystal structure of pepv (see paper)
33% identity, 39% coverage: 13:163/391 of query aligns to 18:175/468 of 1lfwA
Sites not aligning to the query:
P45494 Beta-Ala-Xaa dipeptidase; Beta-Ala-His dipeptidase; Peptidase V; EC 3.4.13.- from Lactobacillus delbrueckii subsp. lactis (see paper)
33% identity, 39% coverage: 13:163/391 of query aligns to 18:175/470 of P45494
Sites not aligning to the query:
P37111 Aminoacylase-1; ACY-1; N-acyl-L-amino-acid amidohydrolase; EC 3.5.1.14 from Sus scrofa (Pig) (see paper)
26% identity, 66% coverage: 52:308/391 of query aligns to 53:320/407 of P37111
Sites not aligning to the query:
3rzaA Crystal structure of a tripeptidase (sav1512) from staphylococcus aureus subsp. Aureus mu50 at 2.10 a resolution
24% identity, 96% coverage: 6:380/391 of query aligns to 3:366/373 of 3rzaA
3pfoA Crystal structure of a putative acetylornithine deacetylase (rpa2325) from rhodopseudomonas palustris cga009 at 1.90 a resolution
30% identity, 51% coverage: 56:255/391 of query aligns to 82:288/426 of 3pfoA
Sites not aligning to the query:
>BWI76_RS10270 FitnessBrowser__Koxy:BWI76_RS10270
MFSYQVDSARMKKDLATLVAINTENPPGHEREAAECLEGWLLTAGFDLSFSEYAPGRTNV
IAVLHNGPGQCFAFNTHIDTVPAGSGWTSDPFTLAERGGRLYGRGACDAKGPLVAMVEAL
RLLAATRQRWSGTLMGVFTADEEVASEGAKFYVRDNPPAIDFAVIGEPTSNATFSAHKGS
LRPRVRVKGVTAHSGTPELGVNAIYQSARLLGLIEEAHHQQVRCRCHDLVGNASLTVTRI
HGGHADNVVPDSCELLLDRRMVPGEDEAVVKAELQQLLDHAHAHAGVEAEIIAWQPTTGG
ATQTDSSEAIVEQSLAACRRHGQSEPGPFGFQGGCDLVHFRSLGAKGVVIGPGSLAVAHK
PDEFVPVDEFIAAAYIYLDIALAMLPPEPGL
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory