SitesBLAST
Comparing BWI76_RS10365 FitnessBrowser__Koxy:BWI76_RS10365 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
7z79B Crystal structure of aminotransferase-like protein from variovorax paradoxus
66% identity, 92% coverage: 9:302/321 of query aligns to 3:295/306 of 7z79B
- binding pyridoxal-5'-phosphate: W46 (= W52), R65 (= R71), N166 (= N172), S202 (= S208), T203 (= T209), F222 (= F228), G224 (= G230), I225 (= I231), T226 (= T232), G261 (= G267), T262 (= T268)
5mr0D Thermophilic archaeal branched-chain amino acid transaminases from geoglobus acetivorans and archaeoglobus fulgidus: biochemical and structural characterisation (see paper)
34% identity, 89% coverage: 24:308/321 of query aligns to 4:287/290 of 5mr0D
- active site: F32 (≠ W52), G34 (= G54), K150 (≠ N172), E183 (≠ S205), L206 (≠ F228)
- binding 3-[o-phosphonopyridoxyl]--amino-benzoic acid: R51 (= R71), G100 (≠ N122), L101 (≠ Q123), K150 (≠ N172), Y154 (≠ R176), E183 (≠ S205), G186 (≠ S208), D187 (≠ T209), L206 (≠ F228), I209 (= I231), T210 (= T232), G245 (= G267), T246 (= T268)
5e25A Crystal structure of branched-chain aminotransferase from thermophilic archaea geoglobus acetivorans complexed with alpha-ketoglutarate (see paper)
37% identity, 80% coverage: 24:281/321 of query aligns to 5:260/290 of 5e25A
- active site: F33 (≠ W52), G35 (= G54), K151 (≠ N172), E184 (≠ S205), L207 (≠ F228)
- binding 2-oxoglutaric acid: Y88 (≠ H108), K151 (≠ N172), T247 (= T268), A248 (≠ L269)
- binding pyridoxal-5'-phosphate: R52 (= R71), K151 (≠ N172), Y155 (≠ R176), E184 (≠ S205), G187 (≠ S208), D188 (≠ T209), L207 (≠ F228), G209 (= G230), I210 (= I231), T211 (= T232), G246 (= G267), T247 (= T268)
7p3tB Transaminase of gamma-proteobacterium (see paper)
35% identity, 87% coverage: 19:298/321 of query aligns to 1:279/299 of 7p3tB
- binding pyridoxal-5'-phosphate: R53 (= R71), K153 (≠ N172), R157 (= R176), E186 (≠ S205), S187 (≠ C206), A188 (≠ N207), A189 (≠ S208), S190 (≠ T209), G210 (= G230), I211 (= I231), T212 (= T232), T248 (= T268)
6thqB Crystal structure of branched-chain aminotransferase from thermophilic archaea thermoproteus uzoniensis with norvaline
30% identity, 90% coverage: 19:307/321 of query aligns to 4:291/301 of 6thqB
- active site: F37 (≠ W52), K156 (≠ D168), E190 (≠ S205), L214 (≠ F228)
- binding pyridoxal-5'-phosphate: R60 (= R71), K156 (≠ D168), Y161 (≠ R176), E190 (≠ S205), N195 (= N210), L214 (≠ F228), G216 (= G230), I217 (= I231), T218 (= T232), T254 (= T268)
- binding 2-[o-phosphonopyridoxyl]-amino-pentanoic acid: R60 (= R71), Y97 (≠ H108), K156 (≠ D168), Y161 (≠ R176), E190 (≠ S205), G193 (≠ S208), E194 (≠ T209), N195 (= N210), G216 (= G230), I217 (= I231), T218 (= T232), G253 (= G267), T254 (= T268), A255 (≠ L269)
4whxA X-ray crystal structure of an amino acid aminotransferase from burkholderia pseudomallei bound to the co-factor pyridoxal phosphate
28% identity, 92% coverage: 23:317/321 of query aligns to 8:305/306 of 4whxA
2ej0B Crystal structure of t.Th.Hb8 branched-chain amino acid aminotransferase with pyridoxamine 5'-phosphate
30% identity, 80% coverage: 24:281/321 of query aligns to 7:268/305 of 2ej0B
- active site: F35 (≠ W52), G37 (= G54), K158 (≠ N172), E192 (≠ S205), L215 (≠ F228)
- binding 4'-deoxy-4'-aminopyridoxal-5'-phosphate: R58 (= R71), Y163 (≠ R176), E192 (≠ S205), G195 (≠ S208), E196 (≠ T209), L215 (≠ F228), G217 (= G230), I218 (= I231), T219 (= T232), G254 (= G267), T255 (= T268)
2ej3A Crystal structure of t.Th.Hb8 branched-chain amino acid aminotransferase complexed with gabapentin
29% identity, 80% coverage: 24:281/321 of query aligns to 7:260/297 of 2ej3A
- active site: F35 (≠ W52), G37 (= G54), K150 (≠ N172), E184 (≠ S205), L207 (≠ F228)
- binding [1-(aminomethyl)cyclohexyl]acetic acid: G187 (≠ S208), G246 (= G267), T247 (= T268), A248 (≠ L269)
- binding pyridoxal-5'-phosphate: R58 (= R71), K150 (≠ N172), Y155 (≠ R176), E184 (≠ S205), G187 (≠ S208), L207 (≠ F228), G209 (= G230), I210 (= I231), T211 (= T232), G246 (= G267), T247 (= T268)
2eiyA Crystal structure of t.Th.Hb8 branched-chain amino acid aminotransferase complexed with 4-methylvaleric acid
29% identity, 80% coverage: 24:281/321 of query aligns to 7:260/297 of 2eiyA
- active site: F35 (≠ W52), G37 (= G54), K150 (≠ N172), E184 (≠ S205), L207 (≠ F228)
- binding 4-methyl valeric acid: F35 (≠ W52), Y94 (≠ H108), T247 (= T268), A248 (≠ L269)
- binding pyridoxal-5'-phosphate: R58 (= R71), K150 (≠ N172), Y155 (≠ R176), E184 (≠ S205), G187 (≠ S208), E188 (≠ T209), L207 (≠ F228), G209 (= G230), I210 (= I231), T211 (= T232), G246 (= G267), T247 (= T268)
1wrvA Crystal structure of t.Th.Hb8 branched-chain amino acid aminotransferase
29% identity, 80% coverage: 24:281/321 of query aligns to 7:260/297 of 1wrvA
- active site: F35 (≠ W52), G37 (= G54), K150 (≠ N172), E184 (≠ S205), L207 (≠ F228)
- binding pyridoxal-5'-phosphate: R58 (= R71), K150 (≠ N172), Y155 (≠ R176), E184 (≠ S205), G187 (≠ S208), L207 (≠ F228), G209 (= G230), I210 (= I231), T211 (= T232), T247 (= T268)
3lqsA Complex structure of d-amino acid aminotransferase and 4-amino-4,5- dihydro-thiophenecarboxylic acid (adta) (see paper)
30% identity, 79% coverage: 27:281/321 of query aligns to 6:254/280 of 3lqsA
- active site: Y31 (≠ W52), V33 (≠ G54), K145 (≠ F167), E177 (≠ S205), L201 (≠ F228)
- binding 4-[({3-hydroxy-2-methyl-5-[(phosphonooxy)methyl]pyridin-4-yl}methyl)amino]thiophene-2-carboxylic acid: V33 (≠ G54), R50 (= R71), E177 (≠ S205), S180 (= S208), S181 (≠ T209), N182 (= N210), L201 (≠ F228), G203 (= G230), I204 (= I231), T205 (= T232), S240 (≠ G267), T241 (= T268), T242 (≠ L269)
3daaA Crystallographic structure of d-amino acid aminotransferase inactivated by pyridoxyl-d-alanine (see paper)
30% identity, 79% coverage: 27:281/321 of query aligns to 6:254/277 of 3daaA
- active site: Y31 (≠ W52), V33 (≠ G54), K145 (≠ F167), E177 (≠ S205), L201 (≠ F228)
- binding n-(5'-phosphopyridoxyl)-d-alanine: Y31 (≠ W52), R50 (= R71), K145 (≠ F167), E177 (≠ S205), S180 (= S208), S181 (≠ T209), L201 (≠ F228), G203 (= G230), I204 (= I231), T205 (= T232), S240 (≠ G267), T241 (= T268)
2daaA Crystallographic structure of d-amino acid aminotransferase inactivated by d-cycloserine
30% identity, 79% coverage: 27:281/321 of query aligns to 6:254/277 of 2daaA
- active site: Y31 (≠ W52), V33 (≠ G54), K145 (≠ F167), E177 (≠ S205), L201 (≠ F228)
- binding d-[3-hydroxy-2-methyl-5-phosphonooxymethyl-pyridin-4-ylmethyl]-n,o-cycloserylamide: Y31 (≠ W52), V33 (≠ G54), R50 (= R71), R98 (≠ T120), H100 (≠ N122), K145 (≠ F167), E177 (≠ S205), S180 (= S208), S181 (≠ T209), N182 (= N210), L201 (≠ F228), G203 (= G230), I204 (= I231), T205 (= T232), T241 (= T268)
1daaA Crystallographic structure of d-amino acid aminotransferase complexed with pyridoxal-5'-phosphate (see paper)
30% identity, 79% coverage: 27:281/321 of query aligns to 6:254/277 of 1daaA
- active site: Y31 (≠ W52), V33 (≠ G54), K145 (≠ F167), E177 (≠ S205), L201 (≠ F228)
- binding pyridoxal-5'-phosphate: R50 (= R71), K145 (≠ F167), E177 (≠ S205), S180 (= S208), S181 (≠ T209), L201 (≠ F228), G203 (= G230), I204 (= I231), T205 (= T232), S240 (≠ G267), T241 (= T268)
P19938 D-alanine aminotransferase; D-amino acid aminotransferase; D-amino acid transaminase; DAAT; D-aspartate aminotransferase; EC 2.6.1.21 from Bacillus sp. (strain YM-1) (see 5 papers)
30% identity, 79% coverage: 27:281/321 of query aligns to 7:255/283 of P19938
- Y32 (≠ W52) binding
- R51 (= R71) binding
- R99 (≠ T120) binding
- H101 (≠ N122) binding
- K146 (≠ F167) active site, Proton acceptor; modified: N6-(pyridoxal phosphate)lysine
- E178 (≠ S205) binding ; mutation to K: Loss of transaminase activity and small gain in racemase activity.
- L202 (≠ F228) mutation to A: Inactivates enzyme.
Sites not aligning to the query:
- 1 modified: Initiator methionine, Removed
1a0gB L201a mutant of d-amino acid aminotransferase complexed with pyridoxamine-5'-phosphate (see paper)
30% identity, 79% coverage: 27:281/321 of query aligns to 6:254/282 of 1a0gB
- active site: Y31 (≠ W52), V33 (≠ G54), K145 (≠ F167), E177 (≠ S205), A201 (≠ C227)
- binding 4'-deoxy-4'-aminopyridoxal-5'-phosphate: R50 (= R71), K145 (≠ F167), E177 (≠ S205), S180 (= S208), S181 (≠ T209), G203 (= G230), I204 (= I231), T205 (= T232), S240 (≠ G267), T241 (= T268)
2ej2A Crystal structure of t.Th.Hb8 branched-chain amino acid aminotransferase complexed with n-(5'-phosphopyridoxyl)-l-glutamate
28% identity, 80% coverage: 24:281/321 of query aligns to 7:257/294 of 2ej2A
- active site: F35 (≠ W52), G37 (= G54), K147 (≠ N172), E181 (≠ S205), L204 (≠ F228)
- binding 4-[(1,3-dicarboxy-propylamino)-methyl]-3-hydroxy-2-methyl-5-phosphonooxymethyl-pyridinium: R58 (= R71), Y94 (≠ H108), Y152 (≠ R176), E181 (≠ S205), G184 (≠ S208), E185 (≠ T209), L204 (≠ F228), G206 (= G230), I207 (= I231), T208 (= T232), T244 (= T268), A245 (≠ L269)
7dbeB Structure of a novel transaminase
29% identity, 80% coverage: 25:280/321 of query aligns to 42:297/332 of 7dbeB
- binding pyridoxal-5'-phosphate: R88 (= R71), K190 (≠ N172), E223 (≠ S205), G226 (≠ S208), F227 (≠ T209), N228 (= N210), L245 (≠ F228), G247 (= G230), I248 (= I231), T249 (= T232), T285 (= T268)
8ivpB Crystal structure of mv in complex with llp and fru from mycobacterium vanbaalenii
27% identity, 84% coverage: 25:294/321 of query aligns to 32:302/322 of 8ivpB
4uugA The (r)-selective amine transaminase from aspergillus fumigatus with inhibitor bound (see paper)
24% identity, 89% coverage: 25:311/321 of query aligns to 30:318/320 of 4uugA
- active site: Y57 (≠ W52), K178 (≠ N172), E211 (≠ S205), L233 (≠ F228)
- binding 3-[o-phosphonopyridoxyl]--amino-benzoic acid: R76 (= R71), K178 (≠ N172), E211 (≠ S205), G214 (≠ S208), F215 (≠ T209), N216 (= N210), L233 (≠ F228), G235 (= G230), I236 (= I231), T237 (= T232), T272 (≠ G267), T273 (= T268), A274 (≠ L269)
Query Sequence
>BWI76_RS10365 FitnessBrowser__Koxy:BWI76_RS10365
MSLALSGQSSQAYLQDTRNDNVQVYVNGEFVHRDRATVSVFDSGYVCGDGVWEGLRLVNG
KLIALQAHLDRLFAGAAAIQLNIGHSPEELTDIMYNTLKINGMTDGAHLRLMITRGKKRT
PNQDPRFILGGATIVCVAEYKVVDEQAKRRGLALFTSTYRTSAPDVFDLRLNSHSRLNLI
QALLQALDAGADEALMLDPHGFVASCNSTNFFIIRQGELWTSNGLYCFNGITRRTILSLA
RQQGLGVQERSFTLAEAFTADEAFVTGTLAGITPVSRLDGRRFDLNENPVTQRISGWYQD
YLQQEESPPADNRWTKKNPQR
Or try a new SitesBLAST search
SitesBLAST's Database
SitesBLAST's database includes
(1) SwissProt
entries with experimentally-supported functional features;
and (2) protein structures with bound ligands, from the
BioLip database.
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory