Comparing BWI76_RS10675 FitnessBrowser__Koxy:BWI76_RS10675 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
P23533 Phosphoenolpyruvate-protein phosphotransferase; Phosphotransferase system, enzyme I; EC 2.7.3.9 from Staphylococcus carnosus (strain TM300) (see paper)
38% identity, 60% coverage: 182:680/833 of query aligns to 71:569/573 of P23533
2wqdA Crystal structure of enzyme i of the phosphoenolpyruvate:sugar phosphotransferase system in the dephosphorylated state (see paper)
38% identity, 62% coverage: 163:680/833 of query aligns to 55:569/570 of 2wqdA
Sites not aligning to the query:
2hwgA Structure of phosphorylated enzyme i of the phosphoenolpyruvate:sugar phosphotransferase system (see paper)
41% identity, 54% coverage: 231:680/833 of query aligns to 119:567/572 of 2hwgA
Sites not aligning to the query:
P08839 Phosphoenolpyruvate-protein phosphotransferase; Phosphotransferase system, enzyme I; EC 2.7.3.9 from Escherichia coli (strain K12) (see 2 papers)
41% identity, 54% coverage: 231:680/833 of query aligns to 120:568/575 of P08839
2xz7A Crystal structure of the phosphoenolpyruvate-binding domain of enzyme i in complex with phosphoenolpyruvate from the thermoanaerobacter tengcongensis pep-sugar phosphotransferase system (pts) (see paper)
45% identity, 37% coverage: 370:677/833 of query aligns to 10:317/324 of 2xz7A
2xz9A Crystal structure from the phosphoenolpyruvate-binding domain of enzyme i in complex with pyruvate from the thermoanaerobacter tengcongensis pep-sugar phosphotransferase system (pts) (see paper)
45% identity, 37% coverage: 370:677/833 of query aligns to 3:310/317 of 2xz9A
5lu4A C4-type pyruvate phosphate dikinase: conformational intermediate of central domain in the swiveling mechanism (see paper)
24% identity, 44% coverage: 290:652/833 of query aligns to 445:850/850 of 5lu4A
Sites not aligning to the query:
5jvjB C4-type pyruvate phosphate dikinase: different conformational states of the nucleotide binding domain in the dimer (see paper)
23% identity, 44% coverage: 290:652/833 of query aligns to 372:795/797 of 5jvjB
Sites not aligning to the query:
Q02KR1 Phosphoenolpyruvate synthase; PEP synthase; Pyruvate, water dikinase; EC 2.7.9.2 from Pseudomonas aeruginosa (strain UCBPP-PA14) (see paper)
33% identity, 21% coverage: 439:616/833 of query aligns to 570:750/791 of Q02KR1
Sites not aligning to the query:
Q39735 Pyruvate, phosphate dikinase, chloroplastic; Cold-sensitive pyruvate, orthophosphate dikinase; Pyruvate, orthophosphate dikinase; EC 2.7.9.1 from Flaveria bidentis (Coastal plain yellowtops) (Ethulia bidentis) (see 2 papers)
22% identity, 44% coverage: 290:652/833 of query aligns to 524:951/953 of Q39735
Sites not aligning to the query:
5jvlA C4-type pyruvate phospate dikinase: nucleotide binding domain with bound atp analogue (see paper)
22% identity, 44% coverage: 290:652/833 of query aligns to 445:872/874 of 5jvlA
Sites not aligning to the query:
P22983 Pyruvate, phosphate dikinase; Pyruvate, orthophosphate dikinase; EC 2.7.9.1 from Clostridium symbiosum (Bacteroides symbiosus) (see 4 papers)
24% identity, 43% coverage: 289:643/833 of query aligns to 443:860/874 of P22983
Sites not aligning to the query:
1kc7A Pyruvate phosphate dikinase with bound mg-phosphonopyruvate (see paper)
24% identity, 43% coverage: 289:643/833 of query aligns to 442:859/872 of 1kc7A
Sites not aligning to the query:
O23404 Pyruvate, phosphate dikinase 1, chloroplastic; Pyruvate, orthophosphate dikinase 1; EC 2.7.9.1 from Arabidopsis thaliana (Mouse-ear cress) (see paper)
23% identity, 44% coverage: 289:652/833 of query aligns to 533:960/963 of O23404
5jvlB C4-type pyruvate phospate dikinase: nucleotide binding domain with bound atp analogue (see paper)
24% identity, 33% coverage: 380:652/833 of query aligns to 180:518/520 of 5jvlB
Sites not aligning to the query:
1vbgA Pyruvate phosphate dikinase from maize (see paper)
24% identity, 44% coverage: 290:652/833 of query aligns to 445:872/874 of 1vbgA
Sites not aligning to the query:
P11155 Pyruvate, phosphate dikinase 1, chloroplastic; Pyruvate, orthophosphate dikinase 1; EC 2.7.9.1 from Zea mays (Maize) (see 7 papers)
24% identity, 44% coverage: 290:652/833 of query aligns to 518:945/947 of P11155
Sites not aligning to the query:
1vbhA Pyruvate phosphate dikinase with bound mg-pep from maize (see paper)
24% identity, 34% coverage: 367:652/833 of query aligns to 515:860/862 of 1vbhA
Sites not aligning to the query:
O31645 PTS system mannose-specific EIIBCA component; EIIBCA-Man; EII-Man; EC 2.7.1.191 from Bacillus subtilis (strain 168) (see 2 papers)
27% identity, 17% coverage: 689:832/833 of query aligns to 505:650/650 of O31645
Sites not aligning to the query:
P37349 PEP-dependent dihydroxyacetone kinase, phosphoryl donor subunit DhaM; Dihydroxyacetone kinase subunit M; EC 2.7.1.121 from Escherichia coli (strain K12) (see paper)
26% identity, 36% coverage: 13:311/833 of query aligns to 166:440/472 of P37349
Sites not aligning to the query:
>BWI76_RS10675 FitnessBrowser__Koxy:BWI76_RS10675
MALVIEFICDLPNGVHARPASLVETLCNTFSSSVEWLNIRTEGRGNAKSALAIIGTNTLK
GDRCELIVSGEDEEQAFAALSAFIRDEFPHCDAPLPTAEQMDVQPVPESLSRLNPTLFHA
LPVCAGSAGGRLTHLKSLDLRDLGALPAAGAIEQEQAALDKGLTLLVKNIEFRLLDNDGT
ASAILEAHRSLATDASLRQHLLDGLLSGLSCAEAVVASGEHFCAQFSASGNSYLQERVLD
VRDVCFQLLQHIYGEARFPAPGKLTEEAICLADELTPSQFLELDKTLLKGLLLRSGGTTS
HTVILARSFNIPTLVGVDMEALLPWVDRRVQIDGNAGLVVVNPNQAVARYYQQEAWVQAQ
IRRQQQAWLDKEGRTEDGIRLEVAANIAHSVEATAAFNNGAQSVGLFRTEMLYMDRPSAP
SENELYNIFCQALEPANGRGIIIRTMDIGGDKPVAYLNIPAENNPFLGYRAVRIYAEYQA
LFRTQLRAILRASAHGALKIMIPMISSMEEILWVKEQLADAKQSLRSEHIPFDEKIPLGI
MLEVPSVMFIIDQCCEEIDFFSIGSNDLTQYLLAVDRDNAKVTRHYNSLNPAFLRALDYA
VQAVHRQGKWIGLCGELGAKGSVLPLLVGLGLDELSMSAPSIPATKARLAQLDSRACRQL
LNQAMQCRTSLEVEHLLAQFRMTQQDAPLITPQCITLNSDWRSKEEVIKGMTDNLLLAGR
CRYPRKLEADLWAREAVFSTGLGFSFAIPHSKSEHIEQSTISVARLAQPVAWGDDEAQFV
IMLTLNKHSAGDQHMRIFSRLARRIMHAEFRQSLVTAQSSEAIAALLQRELEL
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory