SitesBLAST
Comparing BWI76_RS10690 FitnessBrowser__Koxy:BWI76_RS10690 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 6 hits to proteins with known functional sites (download)
7cyxA Crystal strcuture of glycine oxidase from bacillus cereus atcc 14579 (see paper)
21% identity, 84% coverage: 29:387/426 of query aligns to 3:349/363 of 7cyxA
- binding flavin-adenine dinucleotide: I7 (≠ V33), G8 (= G34), G10 (= G36), V11 (≠ Y37), I12 (≠ T38), V30 (≠ L56), E31 (= E57), K32 (≠ G58), E38 (≠ G64), A39 (= A65), S40 (= S66), A43 (≠ N69), G45 (= G71), L46 (≠ Q72), V171 (= V207), G200 (= G234), G201 (≠ N235), W203 (≠ Y237), G298 (= G338), R300 (≠ F340), P301 (≠ L341), Y326 (≠ S364), R327 (≠ G365), N328 (≠ H366), G329 (= G367), I330 (≠ V368)
Q63342 Dimethylglycine dehydrogenase, mitochondrial; ME2GLYDH; EC 1.5.8.4 from Rattus norvegicus (Rat) (see 2 papers)
24% identity, 49% coverage: 28:237/426 of query aligns to 43:244/857 of Q63342
- CV 52:53 (≠ YT 37:38) binding
- EK 73:74 (≠ EG 57:58) binding
- 80:88 (vs. 64:73, 30% identical) binding
- H84 (≠ R68) modified: Tele-8alpha-FAD histidine
- V212 (= V207) binding
- W244 (≠ Y237) binding
Sites not aligning to the query:
- 390:395 binding
- 573:575 binding
- 669 binding
- 676:678 binding
- 737 binding
4pabB Crystal structure of the precursor form of rat dmgdh complexed with tetrahydrofolate (see paper)
24% identity, 49% coverage: 28:237/426 of query aligns to 6:207/824 of 4pabB
- active site: T53 (≠ N75), E102 (≠ T136)
- binding flavin-adenine dinucleotide: I11 (≠ V33), G12 (= G34), G14 (= G36), C15 (≠ Y37), V16 (≠ T38), L35 (= L56), E36 (= E57), K37 (≠ G58), G43 (= G64), S44 (≠ A65), T45 (≠ S66), H47 (≠ R68), A48 (≠ N69), A49 (≠ G70), G50 (= G71), L51 (= L73), V175 (= V207), A204 (≠ G234), G205 (≠ N235), W207 (≠ Y237)
Sites not aligning to the query:
- active site: 226, 255, 536
- binding flavin-adenine dinucleotide: 226, 228, 326, 328, 353, 355, 356, 357, 358
- binding (6s)-5,6,7,8-tetrahydrofolate: 523, 536, 538, 550, 612, 613, 632, 639, 680, 700
Q9UI17 Dimethylglycine dehydrogenase, mitochondrial; ME2GLYDH; EC 1.5.8.4 from Homo sapiens (Human) (see 4 papers)
23% identity, 56% coverage: 28:265/426 of query aligns to 50:280/866 of Q9UI17
- CV 59:60 (≠ YT 37:38) binding
- EK 80:81 (≠ EG 57:58) binding
- 87:95 (vs. 64:73, 30% identical) binding
- H91 (≠ R68) modified: Tele-8alpha-FAD histidine
- H109 (≠ T87) to R: in DMGDHD; shows 10 fold lower catalytic efficiency due to lower cofactor saturation and reduced thermal stability; dbSNP:rs121908331
- V219 (= V207) binding
- S279 (≠ A264) to P: in dbSNP:rs532964
Sites not aligning to the query:
- 397:402 binding
- 530 A → G: in dbSNP:rs1805073
- 646 S → P: in dbSNP:rs1805074
S5FMM4 Glycine oxidase; GO; BliGO; EC 1.4.3.19 from Bacillus licheniformis (see paper)
23% identity, 83% coverage: 41:392/426 of query aligns to 18:359/369 of S5FMM4
- G51 (≠ V74) mutation to S: Shows 4.3- and 107-fold increase of affinity to glyphosate and glycine, respectively. Shows 7.1- and 8-fold increase of affinity and catalytic efficiency to glyphosate, respectively, while the substrate affinity to glycine decreases 235-fold and catalytic efficiency decreases 113-fold; when associated with R-54, R-81, C-202, V-332 and V-342.
- A54 (≠ Y77) mutation to R: Shows 7.1- and 8-fold increase of affinity and catalytic efficiency to glyphosate, respectively, while the substrate affinity to glycine decreases 235-fold and catalytic efficiency decreases 113-fold; when associated with S-51, R-81, C-202, V-332 and V-342.
- K81 (≠ G104) mutation to R: Shows 7.1- and 8-fold increase of affinity and catalytic efficiency to glyphosate, respectively, while the substrate affinity to glycine decreases 235-fold and catalytic efficiency decreases 113-fold; when associated with S-51, R-54, C-202, V-332 and V-342.
- S202 (≠ G234) mutation to C: Shows 7.1- and 8-fold increase of affinity and catalytic efficiency to glyphosate, respectively, while the substrate affinity to glycine decreases 235-fold and catalytic efficiency decreases 113-fold; when associated with S-51, R-54, R-81, V-332 and V-342.
- I332 (≠ V368) mutation to V: Shows 7.1- and 8-fold increase of affinity and catalytic efficiency to glyphosate, respectively, while the substrate affinity to glycine decreases 235-fold and catalytic efficiency decreases 113-fold; when associated with S-51, R-54, R-81, C-202 and V-342.
- M342 (≠ I378) mutation to V: Shows 7.1- and 8-fold increase of affinity and catalytic efficiency to glyphosate, respectively, while the substrate affinity to glycine decreases 235-fold and catalytic efficiency decreases 113-fold; when associated with S-51, R-54, R-81, C-202 and V-332.
1y56B Crystal structure of l-proline dehydrogenase from p.Horikoshii (see paper)
21% identity, 80% coverage: 43:382/426 of query aligns to 20:351/374 of 1y56B
- active site: F44 (≠ G67), G47 (= G70), T48 (≠ G71), H224 (≠ T255), P239 (≠ R269), G305 (= G338), M338 (≠ T369)
- binding flavin-adenine dinucleotide: I33 (≠ L56), E34 (= E57), K35 (≠ G58), S42 (≠ A65), T43 (≠ S66), R45 (= R68), C46 (≠ N69), G47 (= G70), G49 (≠ Q72), E170 (≠ P206), V171 (= V207), T200 (≠ G234), N201 (= N235), W203 (≠ Y237), G305 (= G338), Y306 (≠ N339), Y307 (≠ F340), G334 (= G365), H335 (= H366), G336 (= G367), F337 (≠ V368), M338 (≠ T369)
- binding flavin mononucleotide: F44 (≠ G67), R45 (= R68), I260 (≠ D293), R301 (≠ Y334), W303 (= W336)
Sites not aligning to the query:
Query Sequence
>BWI76_RS10690 FitnessBrowser__Koxy:BWI76_RS10690
MSEHTTSYYAASANRYEPFPTLGESISCDVCVVGGGYTGLSSALHLAEMGYDVVLLEGAR
IGFGASGRNGGQLVNSYSRDIDVIEKTYGPDAAKMLGSMMFEGGDIIRERIQRYQIQCDY
RPGGLFVALNHKQLETLEEQKANWERYGNTQLELLDASAIRREVDSDRYAGALLDHSGGH
IHPLNLAIGEADAIRLNGGRVYEQSPVTRIQHSSPAVVTTERGQVTARYVIVAGNAYLGD
KLEPELAKRSMPCGTQVVATAPLAEDLARSLIPKNYCVEDCNYLLDYYRLTADNRLLYGG
GVVYGARDPDDVERLIMPKLLKTFPQLQGVKIDYRWTGNFLLTLSRMPQFGRLDNNIYYM
QGYSGHGVTCTHLAGRLISELLRGDAERFDAFAKLPHYPFPGGRSLRIPFTAMGAAYYSL
RDRLGV
Or try a new SitesBLAST search
SitesBLAST's Database
SitesBLAST's database includes
(1) SwissProt
entries with experimentally-supported functional features;
and (2) protein structures with bound ligands, from the
BioLip database.
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory