Comparing BWI76_RS10705 FitnessBrowser__Koxy:BWI76_RS10705 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 10 hits to proteins with known functional sites (download)
P76038 Gamma-glutamyl-gamma-aminobutyrate hydrolase PuuD; Gamma-Glu-GABA hydrolase; EC 3.5.1.94 from Escherichia coli (strain K12) (see paper)
88% identity, 100% coverage: 1:254/254 of query aligns to 1:254/254 of P76038
6vtvB Crystal structure of puud gamma-glutamyl-gamma-aminobutyrate hydrolase from e. Coli
88% identity, 99% coverage: 3:254/254 of query aligns to 1:252/252 of 6vtvB
7d53A Spua mutant - h221n with glu (see paper)
43% identity, 96% coverage: 8:251/254 of query aligns to 4:249/249 of 7d53A
7d50B Spua mutant - h221n with glutamyl-thioester (see paper)
43% identity, 96% coverage: 8:251/254 of query aligns to 10:255/255 of 7d50B
7d4rB Spua native structure (see paper)
40% identity, 94% coverage: 8:246/254 of query aligns to 2:212/215 of 7d4rB
3fijA Crystal structure of a uncharacterized protein lin1909
36% identity, 94% coverage: 7:246/254 of query aligns to 2:222/224 of 3fijA
O33341 Putative glutamine amidotransferase Rv2859c; EC 2.4.2.- from Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) (see paper)
31% identity, 97% coverage: 7:253/254 of query aligns to 65:304/308 of O33341
1vcnA Crystal structure of t.Th. Hb8 ctp synthetase complex with sulfate anion (see paper)
31% identity, 57% coverage: 103:247/254 of query aligns to 353:505/506 of 1vcnA
Sites not aligning to the query:
Q5SIA8 CTP synthase; Cytidine 5'-triphosphate synthase; Cytidine triphosphate synthetase; CTP synthetase; CTPS; UTP--ammonia ligase; EC 6.3.4.2 from Thermus thermophilus (strain ATCC 27634 / DSM 579 / HB8) (see paper)
34% identity, 48% coverage: 126:247/254 of query aligns to 453:546/550 of Q5SIA8
Sites not aligning to the query:
1vcoA Crystal structure of t.Th. Hb8 ctp synthetase complex with glutamine (see paper)
29% identity, 57% coverage: 103:247/254 of query aligns to 366:529/531 of 1vcoA
Sites not aligning to the query:
>BWI76_RS10705 FitnessBrowser__Koxy:BWI76_RS10705
MENIMYKPVIGVVMCRNRLKGHQTQTLQEKYLNAIVNAGGVPIALPHALAEPELLSALLP
KLDGIYLPGSPSNVQPHLYGENGDEPDADPGRDLLSMALIDAALERRIPIFAICRGLQEL
VVATGGTLYRRLFEQPELLEHREDPELPVEQQYAPSHEVQVQEGGLLSQLIPGCNTFWVN
SLHGQGAKTTGPRLRVEARSPDGLAEAVSVNDHPFALGVQWHPEWNSSEYALSRMLFEGF
ITACQNYVAEKQRL
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory