Comparing BWI76_RS11225 FitnessBrowser__Koxy:BWI76_RS11225 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
2ap1A Crystal structure of the putative regulatory protein
85% identity, 100% coverage: 1:302/303 of query aligns to 3:304/305 of 2ap1A
Q8ZPZ9 N-acetyl-D-glucosamine kinase; GlcNAc kinase; EC 2.7.1.59 from Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)
85% identity, 100% coverage: 1:302/303 of query aligns to 1:302/303 of Q8ZPZ9
7p9lAAA Ubiquitin-like protein SMT3,N-acetyl-D-glucosamine kinase
58% identity, 99% coverage: 1:301/303 of query aligns to 2:303/303 of 7p9lAAA
7p7wBBB Ubiquitin-like protein SMT3,N-acetyl-D-glucosamine kinase
58% identity, 99% coverage: 1:301/303 of query aligns to 5:306/306 of 7p7wBBB
7p9pAAA Ubiquitin-like protein SMT3,N-acetyl-D-glucosamine kinase
58% identity, 99% coverage: 1:301/303 of query aligns to 3:304/304 of 7p9pAAA
4db3A 1.95 angstrom resolution crystal structure of n-acetyl-d-glucosamine kinase from vibrio vulnificus.
52% identity, 99% coverage: 1:301/303 of query aligns to 9:309/311 of 4db3A
6jdbA Crystal structure of n-acetyl mannosmaine kinase in complex with mannac-6p and adp from haemophilus influenzae
28% identity, 97% coverage: 5:298/303 of query aligns to 6:283/290 of 6jdbA
2qm1B Crystal structure of glucokinase from enterococcus faecalis
28% identity, 98% coverage: 4:301/303 of query aligns to 10:320/325 of 2qm1B
3vovB Crystal structure of rok hexokinase from thermus thermophilus (see paper)
33% identity, 97% coverage: 4:298/303 of query aligns to 5:289/298 of 3vovB
Q93LQ8 Beta-glucoside kinase; EC 2.7.1.85 from Klebsiella pneumoniae (see paper)
26% identity, 99% coverage: 5:303/303 of query aligns to 6:287/297 of Q93LQ8
3vglA Crystal structure of a rok family glucokinase from streptomyces griseus in complex with glucose and amppnp (see paper)
30% identity, 85% coverage: 1:257/303 of query aligns to 2:263/312 of 3vglA
Sites not aligning to the query:
3vgkB Crystal structure of a rok family glucokinase from streptomyces griseus (see paper)
30% identity, 85% coverage: 1:257/303 of query aligns to 2:263/312 of 3vgkB
6jdcA Crystal structure of n-acetyl mannosmaine kinase in complex with mannac from haemophilus influenzae
27% identity, 97% coverage: 5:298/303 of query aligns to 6:263/269 of 6jdcA
6jdoA Crystal structure of n-acetyl mannosmaine kinase with amp-pnp from pasteurella multocida
24% identity, 97% coverage: 5:298/303 of query aligns to 6:284/293 of 6jdoA
6jdhA Crystal structure of n-acetyl mannosmaine kinase from pasteurella multocida
24% identity, 97% coverage: 5:298/303 of query aligns to 6:284/293 of 6jdhA
P32718 D-allose kinase; Allokinase; EC 2.7.1.55 from Escherichia coli (strain K12) (see paper)
28% identity, 98% coverage: 4:299/303 of query aligns to 10:295/309 of P32718
2gupA Structural genomics, the crystal structure of a rok family protein from streptococcus pneumoniae tigr4 in complex with sucrose
27% identity, 87% coverage: 5:269/303 of query aligns to 6:248/289 of 2gupA
Sites not aligning to the query:
5f7rA Rok repressor lmo0178 from listeria monocytogenes bound to inducer (see paper)
25% identity, 79% coverage: 32:269/303 of query aligns to 38:273/306 of 5f7rA
Sites not aligning to the query:
5f7qE Rok repressor lmo0178 from listeria monocytogenes bound to operator (see paper)
23% identity, 90% coverage: 32:303/303 of query aligns to 119:388/396 of 5f7qE
Sites not aligning to the query:
1z05A Crystal structure of the rok family transcriptional regulator, homolog of e.Coli mlc protein.
22% identity, 83% coverage: 47:299/303 of query aligns to 122:380/396 of 1z05A
>BWI76_RS11225 FitnessBrowser__Koxy:BWI76_RS11225
MYYGFDIGGSKIALGIFDKARRLQWEKRVATPKESYEAFLQAVEALVQEADQRFGCQGSV
GIGIPGMPETEDGTLYAANVPAASGRRLRADLSERLGRDVRLDNDANCFALSEAWDDEFT
QYPLVMGLILGTGVGGGLVLNGKSITGHRYITGEFGHIRLPVDALEVVGRDFPLTRCGCG
QLGCIENYLSGRGFAWLYQHFYQQSLTSPEIVALWQQGDAKAREHVERYLDLLAVCLGNI
LTIVDPDLLVLGGGLSNFTAITEGLAQRLPRHLLPVASVPRIERARHGDAGGMRGAAFLH
LTQ
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory