Comparing BWI76_RS11560 FitnessBrowser__Koxy:BWI76_RS11560 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
P77256 NADH-specific methylglyoxal reductase; AKR11B2; EC 1.1.1.- from Escherichia coli (strain K12) (see paper)
86% identity, 99% coverage: 1:325/327 of query aligns to 1:325/326 of P77256
P46336 Aldo-keto reductase IolS; AKR11A; Vegetative protein 147; VEG147; EC 1.1.1.- from Bacillus subtilis (strain 168) (see paper)
32% identity, 96% coverage: 1:313/327 of query aligns to 1:301/310 of P46336
1pz0A Structure of NADPH-dependent family 11 aldo-keto reductase akr11a(holo) (see paper)
32% identity, 95% coverage: 2:313/327 of query aligns to 1:300/311 of 1pz0A
P80874 Aldo-keto reductase YhdN; AKR11B; General stress protein 69; GSP69; EC 1.1.1.- from Bacillus subtilis (strain 168) (see paper)
36% identity, 91% coverage: 1:298/327 of query aligns to 1:287/331 of P80874
1pz1A Structure of NADPH-dependent family 11 aldo-keto reductase akr11b(holo) (see paper)
36% identity, 91% coverage: 1:298/327 of query aligns to 1:287/333 of 1pz1A
Q3L181 Perakine reductase; EC 1.1.1.317 from Rauvolfia serpentina (Serpentine wood) (Ophioxylon serpentinum) (see paper)
31% identity, 99% coverage: 1:324/327 of query aligns to 1:309/337 of Q3L181
3v0sA Crystal structure of perakine reductase, founder member of a novel akr subfamily with unique conformational changes during NADPH binding (see paper)
30% identity, 99% coverage: 1:324/327 of query aligns to 1:277/287 of 3v0sA
1ynqB Aldo-keto reductase akr11c1 from bacillus halodurans (holo form) (see paper)
33% identity, 99% coverage: 1:323/327 of query aligns to 2:290/298 of 1ynqB
1ynpB Aldo-keto reductase akr11c1 from bacillus halodurans (apo form) (see paper)
33% identity, 99% coverage: 1:323/327 of query aligns to 2:290/298 of 1ynpB
1ynpA Aldo-keto reductase akr11c1 from bacillus halodurans (apo form) (see paper)
32% identity, 99% coverage: 1:323/327 of query aligns to 2:275/283 of 1ynpA
5danA Crystal structure of a novel aldo keto reductase tm1743 from thermotoga maritima in complex with NADP+
28% identity, 97% coverage: 6:321/327 of query aligns to 6:274/274 of 5danA
6kiyA Crystal structure of a thermostable aldo-keto reductase tm1743 in complex with inhibitor epalrestat (see paper)
28% identity, 97% coverage: 6:321/327 of query aligns to 7:275/275 of 6kiyA
6kikA Crystal structure of a thermostable aldo-keto reductase tm1743 in complex with inhibitor tolrestat (see paper)
28% identity, 97% coverage: 6:321/327 of query aligns to 7:275/275 of 6kikA
6ow0A Crystal structure of mithramycin 3-side chain keto-reductase mtmw in complex with NAD+ and peg (see paper)
32% identity, 86% coverage: 37:318/327 of query aligns to 32:311/323 of 6ow0A
Sites not aligning to the query:
8hw0A The structure of akr6d1
28% identity, 93% coverage: 1:305/327 of query aligns to 1:301/329 of 8hw0A
P63144 Voltage-gated potassium channel subunit beta-1; K(+) channel subunit beta-1; Kv-beta-1; EC 1.1.1.- from Rattus norvegicus (Rat) (see paper)
28% identity, 94% coverage: 1:307/327 of query aligns to 71:373/401 of P63144
Q14722 Voltage-gated potassium channel subunit beta-1; K(+) channel subunit beta-1; Kv-beta-1; EC 1.1.1.- from Homo sapiens (Human) (see paper)
28% identity, 92% coverage: 6:307/327 of query aligns to 94:391/419 of Q14722
6ow0B Crystal structure of mithramycin 3-side chain keto-reductase mtmw in complex with NAD+ and peg (see paper)
32% identity, 86% coverage: 37:318/327 of query aligns to 28:287/301 of 6ow0B
Sites not aligning to the query:
1exbA Structure of the cytoplasmic beta subunit-t1 assembly of voltage- dependent k channels (see paper)
29% identity, 92% coverage: 6:307/327 of query aligns to 7:304/326 of 1exbA
3eauA Voltage-dependent k+ channel beta subunit in complex with cortisone (see paper)
29% identity, 92% coverage: 6:307/327 of query aligns to 8:305/327 of 3eauA
>BWI76_RS11560 FitnessBrowser__Koxy:BWI76_RS11560
MKMIPLGSTDIRLSRMGLGTWAIGGGPAWNGDLDLRICIDTIIEAHRCGINLIDTAPGYN
FGNSEVIVGQALKQLPRRDIVVETKCGIVWERTGSLFNKVGDRQLYKNLTPESIREEVDA
SLQRLGIDTIDIYMTHWQSVEPCFTPIAETVATLNALKKEGKIRAIGAANVDAGHIREYL
KHGELDIVQAKYSILDRALEAELLPLCQQNGIVVQVYSPLEQGLLSGTITRDYVPGGARA
NKVWFQRENMLRVIDMLEQWQPLCEKYRCAIPALALAWILKQSDLITLLSGATAPEQVRE
NIDALTIALTDDDSLLMRQMAQALETQ
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory