Comparing BWI76_RS11890 FitnessBrowser__Koxy:BWI76_RS11890 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
5wabA Crystal structure of bifidobacterium adolescentis gh3 beta-glucosidase (see paper)
38% identity, 91% coverage: 12:722/785 of query aligns to 8:667/674 of 5wabA
2x41A Structure of beta-glucosidase 3b from thermotoga neapolitana in complex with glucose (see paper)
35% identity, 90% coverage: 6:708/785 of query aligns to 4:715/715 of 2x41A
2x42A Structure of beta-glucosidase 3b from thermotoga neapolitana in complex with alpha-d-glucose (see paper)
35% identity, 90% coverage: 6:708/785 of query aligns to 4:715/715 of 2x42A
7zgzX Crystal structure of beta-xylosidase from thermotoga maritima in complex with methyl-beta-d-xylopyranoside hydrolysed to xylose
30% identity, 78% coverage: 97:707/785 of query aligns to 110:737/753 of 7zgzX
Sites not aligning to the query:
4i8dB Crystal structure of beta-d-glucoside glucohydrolase from trichoderma reesei (see paper)
29% identity, 77% coverage: 96:700/785 of query aligns to 70:713/714 of 4i8dB
Sites not aligning to the query:
4i8dA Crystal structure of beta-d-glucoside glucohydrolase from trichoderma reesei (see paper)
29% identity, 77% coverage: 96:700/785 of query aligns to 67:710/711 of 4i8dA
Sites not aligning to the query:
7zb3A Crystal structure of beta-xylosidase from thermotoga maritima in complex with xylohexaose hydrolysed to xylobiose
30% identity, 78% coverage: 97:707/785 of query aligns to 110:748/765 of 7zb3A
Sites not aligning to the query:
7zdyW Crystal structure of beta-xylosidase from thermotoga maritima in complex with methyl-beta-d-xylopyranoside
30% identity, 78% coverage: 97:707/785 of query aligns to 110:748/763 of 7zdyW
Sites not aligning to the query:
5tf0A Crystal structure of glycosil hydrolase family 3 n-terminal domain protein from bacteroides intestinalis
30% identity, 76% coverage: 100:695/785 of query aligns to 82:729/733 of 5tf0A
6jxgA Crystasl structure of beta-glucosidase d2-bgl from chaetomella raphigera (see paper)
31% identity, 76% coverage: 100:699/785 of query aligns to 70:711/713 of 6jxgA
5yqsA Isoprimeverose-producing enzyme from aspergillus oryzae in complex with isoprimeverose (see paper)
29% identity, 77% coverage: 99:700/785 of query aligns to 110:753/754 of 5yqsA
Sites not aligning to the query:
7eapA Crystal structure of ipea-xxxg complex (see paper)
29% identity, 77% coverage: 99:700/785 of query aligns to 111:754/755 of 7eapA
Sites not aligning to the query:
3u48B From soil to structure: a novel dimeric family 3-beta-glucosidase isolated from compost using metagenomic analysis
28% identity, 88% coverage: 1:692/785 of query aligns to 2:727/742 of 3u48B
6r5nA The crystal structure of glycoside hydrolase bglx from p. Aeruginosa in complex with 1-deoxynojirimycin (see paper)
31% identity, 75% coverage: 100:689/785 of query aligns to 86:722/733 of 6r5nA
Sites not aligning to the query:
6r5iA The crystal structure of the glycoside hydrolase bglx from p. Aeruginosa (see paper)
31% identity, 75% coverage: 100:689/785 of query aligns to 86:722/733 of 6r5iA
6r5tA The crystal structure of glycoside hydrolase bglx inactive mutant d286n from p. Aeruginosa in complex with lactose (see paper)
31% identity, 75% coverage: 100:689/785 of query aligns to 86:722/733 of 6r5tA
Sites not aligning to the query:
6r5vA The crystal structure of glycoside hydrolase bglx inactive mutant d286n from p. Aeruginosa in complex with xylotriose (see paper)
31% identity, 75% coverage: 100:689/785 of query aligns to 86:719/730 of 6r5vA
Sites not aligning to the query:
6r5oA The crystal structure the glycoside hydrolase bglx inactive mutant d286n from p. Aeruginosa in complex with two glucose molecules (see paper)
31% identity, 75% coverage: 100:689/785 of query aligns to 86:719/730 of 6r5oA
Sites not aligning to the query:
5xxmA Crystal structure of gh3 beta-glucosidase from bacteroides thetaiotaomicron in complex with gluconolactone (see paper)
29% identity, 76% coverage: 100:692/785 of query aligns to 93:739/749 of 5xxmA
Sites not aligning to the query:
5xxnA Crystal structure of mutant (d286n) beta-glucosidase from bacteroides thetaiotaomicron in complex with sophorose (see paper)
28% identity, 76% coverage: 100:692/785 of query aligns to 82:728/744 of 5xxnA
Sites not aligning to the query:
>BWI76_RS11890 FitnessBrowser__Koxy:BWI76_RS11890
MSNDFNTTLAAMSAEEKVALLTGSGLWRTASLPQHGIEDIIMTDGTYGVRYSSAQIDGRE
KWSMDDFISVITQTADQASVAEPAAKGGSEALFSTSLPATCFPNGSSLACSWDVELVHQM
GQALGRECQQMGVGILLGPGINIRRTPLAGRGYEYYAEDPVVSGDIAAALINGLQQEGVG
ASLKHFAANNSEFRRTEMDSIIEERALREIYLAGFQRAIAKSRPWTVMSSYNRLNGVQTS
QDPFLLTQVLRDEWGYDGLVMSDWYGIKDRPASLMAGNDLAMPETRRDKQTLLAAIEAEE
VPMAVVDRACLRMLELLDKVQRHRRPQTRADFTAHHALAQRLAGESIVLLKNEEALLPLR
SEKTPRIAVLGKPAQEPVIQGSGCATTVPYLLDRPLDEIFDLAGDDFSVTWAVGAPDDLR
DDEQALAQACSVAQEADVAVLFVSTAVGEDGENGDRQDLHILPVHERLIREVAAVQPNIV
VVLANSDAVVMPWLGECKALLETFFAGQGMGRAVAEILFGKRNPCGKLTVTVPNSLEETP
AWLHYPGENLRHYYGEGLFVGYRYYDKRRLMPQFPFGFGLSYTRFAYDNIALSASRLGAD
ETLTVSFDLTNCGEYAGKEIVQLYVSAPKGELIREVQSLKAFSKVALAAGESRRVSLQLP
IAELACYHPGLGDWMVTPGIWQIRVGASSRDLPLTAEMEVDCPQRYVPLRDDNSLQQLIQ
QPEAFARVVTLIADKSQIPAEQVREKLIRLAPDLFCGLLIALTEFLALDIERDELNAVLA
GAHHC
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory