Comparing BWI76_RS12840 FitnessBrowser__Koxy:BWI76_RS12840 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
3c4jA Abc protein artp in complex with atp-gamma-s
51% identity, 49% coverage: 258:503/506 of query aligns to 4:241/242 of 3c4jA
3c41J Abc protein artp in complex with amp-pnp/mg2+
51% identity, 49% coverage: 258:503/506 of query aligns to 4:241/242 of 3c41J
2olkA Abc protein artp in complex with adp-beta-s
51% identity, 49% coverage: 258:503/506 of query aligns to 4:241/242 of 2olkA
2oljA Abc protein artp in complex with adp/mg2+
51% identity, 49% coverage: 258:503/506 of query aligns to 4:241/242 of 2oljA
4u00A Crystal structure of ttha1159 in complex with adp (see paper)
49% identity, 49% coverage: 256:503/506 of query aligns to 1:239/241 of 4u00A
4ymuJ Crystal structure of an amino acid abc transporter complex with arginines and atps (see paper)
48% identity, 48% coverage: 261:503/506 of query aligns to 5:239/240 of 4ymuJ
P02915 Histidine/lysine/arginine/ornithine transport ATP-binding protein HisP; EC 7.4.2.1 from Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) (see paper)
47% identity, 49% coverage: 255:501/506 of query aligns to 4:254/258 of P02915
1b0uA Atp-binding subunit of the histidine permease from salmonella typhimurium (see paper)
47% identity, 48% coverage: 258:501/506 of query aligns to 3:250/258 of 1b0uA
P69874 Spermidine/putrescine import ATP-binding protein PotA; EC 7.6.2.11 from Escherichia coli (strain K12) (see 3 papers)
39% identity, 46% coverage: 256:488/506 of query aligns to 16:235/378 of P69874
Sites not aligning to the query:
P30750 Methionine import ATP-binding protein MetN; EC 7.4.2.11 from Escherichia coli (strain K12) (see 3 papers)
38% identity, 44% coverage: 264:484/506 of query aligns to 12:224/343 of P30750
Sites not aligning to the query:
6cvlD Crystal structure of the escherichia coli atpgs-bound metni methionine abc transporter in complex with its metq binding protein (see paper)
38% identity, 44% coverage: 264:484/506 of query aligns to 13:225/344 of 6cvlD
Sites not aligning to the query:
3tuzC Inward facing conformations of the metni methionine abc transporter: cy5 semet soak crystal form (see paper)
38% identity, 44% coverage: 264:484/506 of query aligns to 13:225/344 of 3tuzC
Sites not aligning to the query:
3tuiC Inward facing conformations of the metni methionine abc transporter: cy5 native crystal form (see paper)
38% identity, 44% coverage: 264:484/506 of query aligns to 13:225/344 of 3tuiC
Sites not aligning to the query:
P75831 Macrolide export ATP-binding/permease protein MacB; EC 7.6.2.- from Escherichia coli (strain K12) (see paper)
37% identity, 44% coverage: 256:480/506 of query aligns to 3:222/648 of P75831
6z4wA Ftse structure from streptococcus pneumoniae in complex with adp (space group p 1) (see paper)
34% identity, 43% coverage: 265:484/506 of query aligns to 11:222/230 of 6z4wA
6z67B Ftse structure of streptococcus pneumoniae in complex with amppnp at 2.4 a resolution (see paper)
34% identity, 43% coverage: 265:484/506 of query aligns to 11:222/229 of 6z67B
1f3oA Crystal structure of mj0796 atp-binding cassette (see paper)
42% identity, 41% coverage: 273:479/506 of query aligns to 21:223/232 of 1f3oA
Sites not aligning to the query:
5lilA Structure of aggregatibacter actinomycetemcomitans macb bound to atpys (p21) (see paper)
36% identity, 47% coverage: 265:502/506 of query aligns to 15:242/615 of 5lilA
Sites not aligning to the query:
5lj7A Structure of aggregatibacter actinomycetemcomitans macb bound to atp (p21) (see paper)
36% identity, 47% coverage: 265:502/506 of query aligns to 15:242/592 of 5lj7A
1l2tA Dimeric structure of mj0796, a bacterial abc transporter cassette (see paper)
42% identity, 41% coverage: 273:479/506 of query aligns to 21:223/230 of 1l2tA
Sites not aligning to the query:
>BWI76_RS12840 FitnessBrowser__Koxy:BWI76_RS12840
MTFNWNYMLSLLSDVDFWQATWTVIKLSLLTWAFSIVLGFILALAKQSPRKLFNAPARLY
IWLFRSMPLLVLLIFVYNMPQALPSFAPVLNDPFWAGLLAMVLSEAAYIAEIHRGGLLSI
PKGQSEAARALGLRYAGTQWRVVIPQALRVALPALANEYIAIVKLSSLVSVISLTEILMV
GQRLYSQNFLVMETMAAVAFYYILIVTVFDFLLKRLETWLDVTQRKTTRPVDEEMQQMAT
ARRPAMARSVSVAQEPALQASKLHKAYNNVEVLGAVSLQIQPGEVVSVIGPSGSGKTTLI
RLLNGLEQIDNGEIKINGQPFIHLNRQGQQKPRFMENSEHRQNIGMVFQSFNLFPHLTVF
GNLLLAPRYHHLASEGELKQHACELLHKVGMLEHAWKYPHQLSGGQQQRVAIARALMMRP
QIMLFDEPTSALDPEKVNEVLQVIESLAHEGITMVIVTHEMNFAFKVSDRIVFMEKGRVV
CDDTPQAMRDGQHPRVDAFLKDVSLA
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory