Comparing BWI76_RS12915 FitnessBrowser__Koxy:BWI76_RS12915 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 6 hits to proteins with known functional sites (download)
P0AA76 D-galactonate transporter; D-galactonate/H(+) symporter from Escherichia coli (strain K12) (see paper)
22% identity, 91% coverage: 11:428/457 of query aligns to 6:417/430 of P0AA76
P53322 High-affinity nicotinic acid transporter; Nicotinic acid permease from Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Baker's yeast) (see paper)
25% identity, 67% coverage: 17:322/457 of query aligns to 81:382/534 of P53322
6e9nA E. Coli d-galactonate:proton symporter in the inward open form (see paper)
22% identity, 87% coverage: 32:428/457 of query aligns to 10:398/409 of 6e9nA
6e9oA E. Coli d-galactonate:proton symporter mutant e133q in the outward substrate-bound form (see paper)
25% identity, 53% coverage: 32:271/457 of query aligns to 13:235/393 of 6e9oA
Sites not aligning to the query:
Q9C0U9 Uncharacterized transporter PB1C11.03 from Schizosaccharomyces pombe (strain 972 / ATCC 24843) (Fission yeast) (see paper)
25% identity, 63% coverage: 6:294/457 of query aligns to 78:366/570 of Q9C0U9
Sites not aligning to the query:
A0A0H2VG78 Glucose transporter GlcP; Glucose/H(+) symporter from Staphylococcus epidermidis (strain ATCC 12228 / FDA PCI 1200) (see paper)
22% identity, 44% coverage: 51:251/457 of query aligns to 31:225/446 of A0A0H2VG78
Sites not aligning to the query:
>BWI76_RS12915 FitnessBrowser__Koxy:BWI76_RS12915
MSTLAQSAQENHATADEQRVMSKLFRRLVAFLFVLFVFSFLDRINIGFAGLTMSQDLGLT
STMFGLAATLFYVTYVLFGVPSNIMLSRVGARRWIAVIMVVWGVASTCTLFATSAGTLYA
LRMIVGVAEAGFVPGILLYLTWWFPSWYRARANALFMIAMPLTMMFGSMLSGYILALDGV
MNLRGWQWLFLLEGLPSVILGVVTWFYLDDKPADAKWLNADEKQTLQRMMESDRSVNRKM
LTRRPVSLWREVFTPVVVLYILAYFCLTNSLSAINIWTPQILKSFNASSSNITVGLLAAI
PQFCTIVVMMWWSKRSDRLKERKRHTIYPYLFSAAGWLLTSLTAHPLIQLSGLIMASAGA
FTAMTLFWTTPDRAISVGAQAVVLATISGAGNIGSGLSPLLIGVMHDMTGNFNAGLWFMA
GLLVIGALVLVYIPMGGVQAATRIVCDKPVGRRPFWQ
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory