Comparing BWI76_RS13475 FitnessBrowser__Koxy:BWI76_RS13475 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
Q8ZPD3 L-methionine sulfoximine/L-methionine sulfone acetyltransferase; L-amino acid N-acyltransferase; Methionine derivative detoxifier A; MDDA; EC 2.3.1.-; EC 2.3.1.- from Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) (see paper)
78% identity, 99% coverage: 1:171/172 of query aligns to 1:171/171 of Q8ZPD3
3dr8A Structure of ynca, a putative acetyltransferase from salmonella typhimurium with its cofactor acetyl-coa
78% identity, 99% coverage: 1:171/172 of query aligns to 3:173/173 of 3dr8A
A6VCX3 L-methionine sulfoximine/L-methionine sulfone acetyltransferase; Methionine derivative detoxifier A; MDDA; EC 2.3.1.- from Pseudomonas aeruginosa (strain PA7) (see paper)
60% identity, 96% coverage: 2:166/172 of query aligns to 4:169/172 of A6VCX3
2j8mA Structure of p. Aeruginosa acetyltransferase pa4866 (see paper)
60% identity, 96% coverage: 2:166/172 of query aligns to 3:168/171 of 2j8mA
2j8rA Structure of p. Aeruginosa acetyltransferase pa4866 solved in complex with l-methionine sulfoximine (see paper)
60% identity, 96% coverage: 2:166/172 of query aligns to 2:167/170 of 2j8rA
4jwpA Crystal structure of ribosomal-protein-alanine n-acetyltransferase from brucella melitensis in complex with acetyl coa
53% identity, 92% coverage: 1:159/172 of query aligns to 4:162/165 of 4jwpA
4mbuA Crystal structure of n-acetyltransferase from staphylococcus aureus mu50 (see paper)
43% identity, 93% coverage: 3:162/172 of query aligns to 5:164/165 of 4mbuA
2jlmF Structure of a putative acetyltransferase (aciad1637) from acinetobacter baylyi adp1 (see paper)
42% identity, 90% coverage: 14:168/172 of query aligns to 22:177/180 of 2jlmF
4jxrB Crystal structure of a gnat superfamily phosphinothricin acetyltransferase (pat) from sinorhizobium meliloti in complex with accoa
34% identity, 95% coverage: 2:164/172 of query aligns to 4:167/185 of 4jxrB
5dwnA Crystal structure of phosphinothricin n-acetyltransferase from brucella ovis in complex with acetylcoa
35% identity, 97% coverage: 2:167/172 of query aligns to 5:172/181 of 5dwnA
5t7eD Crystal structure of streptomyces hygroscopicus bialaphos resistance (bar) protein in complex with coenzyme a and l-phosphinothricin (see paper)
31% identity, 93% coverage: 3:162/172 of query aligns to 4:162/175 of 5t7eD
5t7dA Crystal structure of streptomyces hygroscopicus bialaphos resistance (bar) protein in complex with acetyl coenzyme a (see paper)
31% identity, 93% coverage: 3:162/172 of query aligns to 3:161/173 of 5t7dA
6m7gA Crystal structure of arsn, n-acetyltransferase with substrate phosphinothricin from pseudomonas putida kt2440 (see paper)
33% identity, 95% coverage: 1:164/172 of query aligns to 2:164/176 of 6m7gA
5wphA Crystal structure of arsn, n-acetyltransferase with substrate ast from pseudomonas putida kt2440 (see paper)
33% identity, 95% coverage: 1:164/172 of query aligns to 2:164/179 of 5wphA
6wqcA Crystal structure of vipf from legionella hackeliae in complex with coa
25% identity, 86% coverage: 3:150/172 of query aligns to 152:292/293 of 6wqcA
Sites not aligning to the query:
6wqbA Crystal structure of vipf from legionella hackeliae in complex with acetyl-coa
26% identity, 86% coverage: 3:150/172 of query aligns to 151:290/290 of 6wqbA
Sites not aligning to the query:
6e1xC Crystal structure of product-bound complex of spermidine/spermine n- acetyltransferase speg
28% identity, 47% coverage: 80:160/172 of query aligns to 85:166/176 of 6e1xC
Sites not aligning to the query:
6e1xA Crystal structure of product-bound complex of spermidine/spermine n- acetyltransferase speg
28% identity, 47% coverage: 80:160/172 of query aligns to 81:162/170 of 6e1xA
Sites not aligning to the query:
4r87A Crystal structure of spermidine n-acetyltransferase from vibrio cholerae in complex with coa and spermine (see paper)
28% identity, 47% coverage: 80:160/172 of query aligns to 81:162/170 of 4r87A
Sites not aligning to the query:
4r57A Crystal structure of spermidine n-acetyltransferase from vibrio cholerae in complex with acetyl-coa (see paper)
28% identity, 47% coverage: 80:160/172 of query aligns to 81:162/170 of 4r57A
Sites not aligning to the query:
>BWI76_RS13475 FitnessBrowser__Koxy:BWI76_RS13475
MTIRHASKDDCAAIAEIYNHAVLHTAAIWNDNTVDTDNRIAWFEARQLVGYPVLVSEENG
VITGYSSFGDWRAFDGFRHTVEHSVYVHPDHQGQGLGRRLLVALIAEAKRLNKHVMVAGI
EAQNQASLHLHDTLGFITTGQMPQVGTKFGRWLDLTFMQLQLDDRRDPDGSA
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory