Comparing BWI76_RS13530 FitnessBrowser__Koxy:BWI76_RS13530 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 8 hits to proteins with known functional sites (download)
P54955 N-acetylcysteine deacetylase; S-(2-succino)cysteine metabolism operon protein P; EC 3.5.1.- from Bacillus subtilis (strain 168)
49% identity, 97% coverage: 6:366/373 of query aligns to 9:372/380 of P54955
O04373 IAA-amino acid hydrolase ILR1-like 4; jasmonoyl-L-amino acid hydrolase; EC 3.5.1.-; EC 3.5.1.127 from Arabidopsis thaliana (Mouse-ear cress) (see paper)
39% identity, 98% coverage: 7:373/373 of query aligns to 48:426/440 of O04373
P54968 IAA-amino acid hydrolase ILR1; EC 3.5.1.- from Arabidopsis thaliana (Mouse-ear cress) (see paper)
35% identity, 98% coverage: 6:372/373 of query aligns to 47:429/442 of P54968
4ewtA The crystal structure of a putative aminohydrolase from methicillin resistant staphylococcus aureus (see paper)
34% identity, 93% coverage: 6:353/373 of query aligns to 15:371/389 of 4ewtA
6slfA Nalpha-acylglutamine aminoacylase from corynebacterium sp.Releasing human axilla odorants co-crystallised with high affinity inhibitor (see paper)
34% identity, 77% coverage: 5:292/373 of query aligns to 20:310/398 of 6slfA
Sites not aligning to the query:
3ramA Crystal structure of hmra (see paper)
28% identity, 72% coverage: 8:275/373 of query aligns to 19:270/391 of 3ramA
Sites not aligning to the query:
3rzaA Crystal structure of a tripeptidase (sav1512) from staphylococcus aureus subsp. Aureus mu50 at 2.10 a resolution
27% identity, 42% coverage: 179:336/373 of query aligns to 186:340/373 of 3rzaA
Sites not aligning to the query:
7uoiA Crystallographic structure of dape from enterococcus faecium
27% identity, 31% coverage: 136:249/373 of query aligns to 152:262/383 of 7uoiA
Sites not aligning to the query:
>BWI76_RS13530 FitnessBrowser__Koxy:BWI76_RS13530
MSLAEQLIRWRRELHQYPELSLQEVDTTARIRDWLQSGGISLLPYDLKTGAVAEVGSGNK
VIALRADIDALPIEEAASVPFRSLNAGVMHACGHDIHTSVILGAALLLKQREAQLAGRVR
ILFQPAEESFGGAKTLIRAGVLEGVSAIFGMHNEPGLPVGEFATRGGAFYANVDRFVFKV
TGKGAHAARPHEGKDAILLASQLVTLLQSVASREVNTLDSVVLSVTRIQGGNTWNVLPES
VELEGTLRTHSSEVQQRVKARVSEIAAGFASAFGAQIDVFWYAGPTALVNDERWAAFASD
VADKSGYRTHHADLHLGGEDFAVYLQHIPGAFVSIGSASEFGLHHPAFNPDERLIAPAAH
YFADLAEQALKEL
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory