SitesBLAST
Comparing BWI76_RS13570 FitnessBrowser__Koxy:BWI76_RS13570 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
Q8ZL58 L-talarate/galactarate dehydratase; TalrD/GalrD; StTGD; EC 4.2.1.156; EC 4.2.1.42 from Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) (see paper)
94% identity, 100% coverage: 1:398/398 of query aligns to 1:398/398 of Q8ZL58
- DAK 46:48 (= DAK 46:48) binding
- KR 82:83 (= KR 82:83) binding
- K195 (= K195) binding
- K197 (= K197) active site, Proton acceptor; mutation to A: Loss of dehydration activity on both L-talarate and galactarate and loss of epimerization activity.
- D226 (= D226) binding
- N228 (= N228) binding
- E252 (= E252) binding
- E278 (= E278) binding
- H328 (= H328) active site, Proton donor/acceptor; mutation H->N,A: Loss of dehydration activity on both L-talarate and galactarate and loss of epimerization activity.
- E348 (= E348) binding
2pp1A Crystal structure of l-talarate/galactarate dehydratase from salmonella typhimurium lt2 liganded with mg and l-lyxarohydroxamate (see paper)
95% identity, 99% coverage: 4:398/398 of query aligns to 1:395/395 of 2pp1A
- active site: K45 (= K48), S78 (= S81), K192 (= K195), K194 (= K197), D223 (= D226), N225 (= N228), E249 (= E252), G274 (= G277), E275 (= E278), D298 (= D301), H325 (= H328), E345 (= E348)
- binding (2r,3s,4r)-2,3,4-trihydroxy-5-(hydroxyamino)-5-oxopentanoic acid: D43 (= D46), K45 (= K48), K79 (= K82), F168 (= F171), K194 (= K197), E275 (= E278), H325 (= H328), E345 (= E348)
- binding magnesium ion: D223 (= D226), E249 (= E252), E275 (= E278)
2pp3A Crystal structure of l-talarate/galactarate dehydratase mutant k197a liganded with mg and l-glucarate (see paper)
95% identity, 99% coverage: 4:398/398 of query aligns to 1:395/395 of 2pp3A
- active site: K45 (= K48), S78 (= S81), K192 (= K195), A194 (≠ K197), D223 (= D226), N225 (= N228), E249 (= E252), G274 (= G277), E275 (= E278), D298 (= D301), H325 (= H328), E345 (= E348)
- binding l-glucaric acid: D43 (= D46), K79 (= K82), K192 (= K195), D223 (= D226), N225 (= N228), E275 (= E278), H325 (= H328), E345 (= E348), F347 (= F350)
- binding magnesium ion: D223 (= D226), E249 (= E252), E275 (= E278)
3cb3A Crystal structure of l-talarate dehydratase from polaromonas sp. Js666 complexed with mg and l-glucarate
69% identity, 93% coverage: 26:397/398 of query aligns to 2:373/373 of 3cb3A
- active site: K24 (= K48), S57 (= S81), T143 (= T167), K171 (= K195), K173 (= K197), D202 (= D226), N204 (= N228), E228 (= E252), G253 (= G277), E254 (= E278), M275 (≠ Q299), D277 (= D301), H304 (= H328), F305 (= F329), A306 (= A330), E324 (= E348)
- binding l-glucaric acid: K171 (= K195), K173 (= K197), D202 (= D226), E254 (= E278), H304 (= H328)
- binding magnesium ion: D202 (= D226), E228 (= E252), A243 (= A267), F246 (≠ L270), E254 (= E278)
2og9A Crystal structure of mandelate racemase/muconate lactonizing enzyme from polaromonas sp. Js666
66% identity, 94% coverage: 26:398/398 of query aligns to 3:363/363 of 2og9A
- active site: S46 (= S81), T132 (= T167), K160 (= K195), K162 (= K197), D191 (= D226), N193 (= N228), E217 (= E252), G242 (= G277), E243 (= E278), M264 (≠ Q299), D266 (= D301), H293 (= H328), F294 (= F329), A295 (= A330), E313 (= E348)
- binding calcium ion: A232 (= A267), F235 (≠ L270)
Q9RKF7 3,6-anhydro-alpha-L-galactonate cycloisomerase; AHGA cycloisomerase; EC 5.5.1.25 from Streptomyces coelicolor (strain ATCC BAA-471 / A3(2) / M145)
34% identity, 89% coverage: 28:380/398 of query aligns to 2:350/361 of Q9RKF7
- D195 (= D226) binding
- E221 (= E252) binding
- E247 (= E278) binding
4h19A Crystal structure of an enolase (mandelate racemase subgroup, target efi-502087) from agrobacterium tumefaciens, with bound mg and d- ribonohydroxamate, ordered loop
34% identity, 91% coverage: 27:387/398 of query aligns to 2:367/372 of 4h19A
- active site: I20 (≠ L50), T51 (≠ I89), T143 (= T167), K172 (= K195), K174 (= K197), D203 (= D226), N205 (= N228), E229 (= E252), G254 (= G277), E255 (= E278), Q276 (= Q299), D278 (= D301), H305 (= H328), A306 (≠ F329), G307 (≠ A330), E327 (= E348)
- binding (2R,3R,4R)-N,2,3,4,5-pentakis(oxidanyl)pentanamide: D22 (≠ G52), H25 (≠ K55), H52 (≠ Y90), K172 (= K195), K174 (= K197), D203 (= D226), N205 (= N228), E229 (= E252), E255 (= E278), H305 (= H328), E327 (= E348)
- binding calcium ion: D268 (≠ L291), H298 (= H321)
- binding magnesium ion: D203 (= D226), E229 (= E252), E255 (= E278)
3ck5A Crystal structure of a racemase from streptomyces coelicolor a3(2) with bound magnesium
34% identity, 89% coverage: 28:380/398 of query aligns to 2:347/357 of 3ck5A
- active site: T19 (≠ S45), T50 (≠ S81), G137 (= G169), K164 (= K195), K166 (= K197), D195 (= D226), N197 (= N228), I220 (= I251), E221 (= E252), I243 (= I274), G246 (= G277), E247 (= E278), E268 (≠ Q299), D270 (= D301), H297 (= H328), G298 (≠ F329), V299 (≠ A330), Y315 (≠ W346), E317 (= E348)
- binding magnesium ion: D195 (= D226), E221 (= E252), E247 (= E278)
5xd8B Crystal structure analysis of 3,6-anhydro-l-galactonate cycloisomerase (see paper)
35% identity, 81% coverage: 28:348/398 of query aligns to 5:319/367 of 5xd8B
- active site: S22 (= S45), T53 (≠ S81), G140 (= G169), K167 (= K195), K169 (= K197), D198 (= D226), N200 (= N228), E224 (= E252), G249 (= G277), E250 (= E278), Q271 (= Q299), D273 (= D301), H300 (= H328), G301 (≠ F329), M302 (≠ A330), W317 (= W346), E319 (= E348)
- binding magnesium ion: D198 (= D226), E224 (= E252), E250 (= E278)
Sites not aligning to the query:
3ugvF Crystal structure of an enolase from alpha pretobacterium bal199 (efi target efi-501650) with bound mg
31% identity, 84% coverage: 50:382/398 of query aligns to 20:355/364 of 3ugvF
- active site: V20 (≠ L50), P51 (≠ S81), P54 (≠ A84), A95 (≠ S125), S137 (≠ T167), K168 (= K195), R170 (≠ K197), D199 (= D226), N201 (= N228), E225 (= E252), G250 (= G277), E251 (= E278), N252 (≠ M279), M272 (≠ Q299), D274 (= D301), A293 (≠ K320), H301 (= H328), L302 (≠ F329), Y303 (≠ A330), E321 (= E348)
- binding magnesium ion: D199 (= D226), E225 (= E252), R240 (≠ A267), L243 (= L270), E251 (= E278)
3sjnA Crystal structure of enolase spea_3858 (target efi-500646) from shewanella pealeana with magnesium bound
34% identity, 71% coverage: 100:383/398 of query aligns to 71:365/373 of 3sjnA
- active site: T139 (= T167), K165 (= K195), G167 (≠ K197), M171 (vs. gap), D198 (= D226), A200 (≠ N228), E225 (= E252), I247 (= I274), G250 (= G277), E251 (= E278), S252 (≠ M279), Q272 (= Q299), D274 (= D301), H301 (= H328), G302 (vs. gap), F303 (vs. gap), M325 (≠ L347), E326 (= E348), Q329 (≠ E351), S331 (≠ L353)
- binding magnesium ion: D198 (= D226), E225 (= E252), E251 (= E278)
Sites not aligning to the query:
4hpnA Crystal structure of a proposed galactarolactone cycloisomerase from agrobacterium tumefaciens, target efi-500704, with bound ca, ordered loops (see paper)
31% identity, 90% coverage: 27:384/398 of query aligns to 2:369/378 of 4hpnA
- active site: F19 (≠ V44), G50 (≠ S81), R53 (= R83), T134 (= T167), K164 (= K195), K166 (= K197), D194 (= D226), N196 (= N228), E220 (= E252), G245 (= G277), E246 (= E278), T247 (≠ M279), Q267 (= Q299), D269 (= D301), H296 (= H328), V297 (vs. gap), W298 (vs. gap), R320 (vs. gap), E329 (= E348), F330 (≠ H349), H334 (≠ L353)
- binding calcium ion: D194 (= D226), D209 (≠ R241), E220 (= E252), G237 (≠ A269), E246 (= E278)
3ozmD Crystal structure of enolase superfamily member from bordetella bronchiseptica complexed with mg, m-xylarate and l-lyxarate
33% identity, 86% coverage: 40:380/398 of query aligns to 12:364/381 of 3ozmD
- active site: M20 (≠ A47), G53 (≠ S81), D56 (≠ A84), S143 (≠ T167), K170 (= K195), K172 (= K197), D200 (= D226), N202 (= N228), E226 (= E252), G252 (= G277), E253 (= E278), N254 (≠ M279), Q274 (= Q299), D276 (= D301), H303 (= H328), T304 (vs. gap), F305 (vs. gap), E328 (= E348), I331 (vs. gap), H333 (= H349)
- binding L-arabinaric acid: K172 (= K197), D200 (= D226), N202 (= N228), E253 (= E278), H303 (= H328), F305 (vs. gap), E328 (= E348)
- binding magnesium ion: D200 (= D226), E226 (= E252), E253 (= E278)
3ozmA Crystal structure of enolase superfamily member from bordetella bronchiseptica complexed with mg, m-xylarate and l-lyxarate
33% identity, 86% coverage: 40:380/398 of query aligns to 12:364/386 of 3ozmA
- active site: M20 (≠ A47), G53 (≠ S81), D56 (≠ A84), S143 (≠ T167), K170 (= K195), K172 (= K197), D200 (= D226), N202 (= N228), E226 (= E252), G252 (= G277), E253 (= E278), N254 (≠ M279), Q274 (= Q299), D276 (= D301), H303 (= H328), T304 (vs. gap), F305 (vs. gap), E328 (= E348), I331 (vs. gap), H333 (= H349)
- binding D-xylaric acid: S24 (≠ T51), K29 (≠ P56), Y146 (≠ G170), K170 (= K195), K172 (= K197), D200 (= D226), N202 (= N228), E253 (= E278), H303 (= H328), F305 (vs. gap), E328 (= E348)
- binding magnesium ion: D200 (= D226), E226 (= E252), E253 (= E278)
3op2A Crystal structure of putative mandelate racemase from bordetella bronchiseptica rb50 complexed with 2-oxoglutarate/phosphate
34% identity, 86% coverage: 40:380/398 of query aligns to 12:359/375 of 3op2A
- active site: M20 (≠ A47), G53 (≠ S81), D56 (≠ A84), S138 (≠ T167), K165 (= K195), K167 (= K197), D195 (= D226), N197 (= N228), E221 (= E252), G247 (= G277), E248 (= E278), N249 (≠ M279), Q269 (= Q299), D271 (= D301), H298 (= H328), T299 (vs. gap), F300 (vs. gap), E323 (= E348), I326 (vs. gap), H328 (= H349)
- binding 2-oxoglutaric acid: K165 (= K195), K167 (= K197), D195 (= D226), E248 (= E278), H298 (= H328), E323 (= E348)
- binding magnesium ion: D195 (= D226), E221 (= E252), E248 (= E278)
4kemA Crystal structure of a tartrate dehydratase from azospirillum, target efi-502395, with bound mg and a putative acrylate ion, ordered active site
33% identity, 71% coverage: 98:378/398 of query aligns to 76:373/390 of 4kemA
- active site: A152 (≠ S168), K181 (= K195), K183 (= K197), V211 (= V225), D212 (= D226), A213 (= A227), N214 (= N228), E238 (= E252), G263 (= G277), E264 (= E278), D284 (vs. gap), Q289 (= Q299), D291 (= D301), R316 (= R323), H321 (= H328), E340 (≠ L347), K347 (≠ N354)
- binding magnesium ion: D212 (= D226), E238 (= E252), E264 (= E278)
Sites not aligning to the query:
P11444 Mandelate racemase; MR; EC 5.1.2.2 from Pseudomonas putida (Arthrobacter siderocapsulatus) (see 3 papers)
30% identity, 66% coverage: 123:383/398 of query aligns to 95:352/359 of P11444
- K166 (= K197) mutation K->A,M,Q: Loss of activity.
- D195 (= D226) binding
- E221 (= E252) binding
- E247 (= E278) binding
- H297 (= H328) mutation to N: Loss of activity.
- E317 (= E348) binding ; mutation to Q: Reduces activity 10000-fold.
7mqxE P. Putida mandelate racemase forms an oxobenzoxaborole adduct with 2- formylphenylboronic acid (see paper)
30% identity, 66% coverage: 123:383/398 of query aligns to 94:351/358 of 7mqxE
Sites not aligning to the query:
6vimA P. Putida mandelate racemase co-crystallized with phenylboronic acid (see paper)
30% identity, 66% coverage: 123:383/398 of query aligns to 93:350/357 of 6vimA
- active site: S137 (≠ T167), K162 (= K195), K164 (= K197), D193 (= D226), N195 (= N228), E219 (= E252), G244 (= G277), E245 (= E278), D268 (= D301), H295 (= H328), L296 (≠ F329), F297 (≠ A330), E315 (= E348)
- binding magnesium ion: D193 (= D226), E219 (= E252), E245 (= E278)
- binding phenyl boronic acid: K162 (= K195), K164 (= K197), D193 (= D226), E245 (= E278), H295 (= H328), L296 (≠ F329), E315 (= E348), L317 (≠ F350)
Sites not aligning to the query:
4x2pA P. Putida mandelate racemase in complex with 3-hydroxypyruvate (see paper)
30% identity, 66% coverage: 123:383/398 of query aligns to 93:350/357 of 4x2pA
- active site: S137 (≠ T167), K162 (= K195), K164 (= K197), D193 (= D226), N195 (= N228), E219 (= E252), G244 (= G277), E245 (= E278), D268 (= D301), M292 (≠ L325), H295 (= H328), L296 (≠ F329), F297 (≠ A330), A311 (≠ E344), E315 (= E348)
- binding 3-hydroxypyruvic acid: K162 (= K195), K164 (= K197), D193 (= D226), H295 (= H328), E315 (= E348)
- binding magnesium ion: D193 (= D226), E219 (= E252), E245 (= E278)
Sites not aligning to the query:
Query Sequence
>BWI76_RS13570 FitnessBrowser__Koxy:BWI76_RS13570
MTSSANSESVTYAKASGVKTAAETGDRIEHVKLSLAFLPLATPVSDAKVLTGRQKPLTEV
AIIIAEIRSRDGFEGVGFSYSKRAGGQGIYAHAKEIADNLLGEDPNDIDKIYTKLLWAGA
SVGRSGMAVQAISPLDIALWDMKAKRAGLPLAKLLGSHRDSVQCYNTSGGFLHTPLDQVL
KNVAISRENGIGGIKLKVGQPNTAEDIRRLTAVREVLGDDFPLMVDANQQWDRETAIRMG
RKMEPFNLIWIEEPLDAYDVEGHAQLAAALDTPIATGEMLTSFREHEQLILGNASDFVQP
DAPRVGGISPFLKIMDLAAKHGRKLAPHFAMEVHLHLAAAYPLEPWLEHFEWLNPLFNEQ
LELRDGRMWVSERHGLGFTLSEQARRWTQQSCEFGKRP
Or try a new SitesBLAST search
SitesBLAST's Database
SitesBLAST's database includes
(1) SwissProt
entries with experimentally-supported functional features;
and (2) protein structures with bound ligands, from the
BioLip database.
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory