Comparing BWI76_RS13700 FitnessBrowser__Koxy:BWI76_RS13700 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
2azqA Crystal structure of catechol 1,2-dioxygenase from pseudomonas arvilla c-1 (see paper)
61% identity, 96% coverage: 11:306/308 of query aligns to 9:305/309 of 2azqA
P07773 Catechol 1,2-dioxygenase; 1,2-CTD; EC 1.13.11.1 from Acinetobacter baylyi (strain ATCC 33305 / BD413 / ADP1) (see paper)
53% identity, 96% coverage: 11:305/308 of query aligns to 11:308/311 of P07773
1dmhA Structure of catechol 1,2-dioxygenase from acinetobacter sp. Adp1 with bound 4-methylcatechol (see paper)
53% identity, 96% coverage: 11:305/308 of query aligns to 9:306/309 of 1dmhA
1dltA Structure of catechol 1,2-dioxygenase from acinetobacter sp. Adp1 with bound catechol (see paper)
53% identity, 96% coverage: 11:305/308 of query aligns to 9:306/309 of 1dltA
1dlmA Structure of catechol 1,2-dioxygenase from acinetobacter calcoaceticus native data (see paper)
53% identity, 96% coverage: 11:305/308 of query aligns to 9:306/309 of 1dlmA
5umhB Crystal structure of catechol 1,2-dioxygenase protein from burkholderia multivorans
50% identity, 96% coverage: 11:307/308 of query aligns to 10:307/310 of 5umhB
2xsrA Crystal structure of wild type acinetobacter radioresistens catechol 1,2 dioxygenase (see paper)
54% identity, 91% coverage: 27:306/308 of query aligns to 26:307/309 of 2xsrA
5td3A Crystal structure of catechol 1,2-dioxygenase from burkholderia vietnamiensis
51% identity, 96% coverage: 11:307/308 of query aligns to 9:306/307 of 5td3A
5vxtB Crystal structure of catechol 1,2-dioxygenase from burkholderia ambifaria
47% identity, 100% coverage: 1:307/308 of query aligns to 5:310/312 of 5vxtB
2boyA Crystal structure of 3-chlorocatechol 1,2-dioxygenase from rhodococcus opacus 1cp (see paper)
29% identity, 86% coverage: 28:292/308 of query aligns to 3:253/253 of 2boyA
3n9tA Cryatal structure of hydroxyquinol 1,2-dioxygenase from pseudomonas putida dll-e4
33% identity, 84% coverage: 10:268/308 of query aligns to 3:258/286 of 3n9tA
3o6rA Crystal structure of 4-chlorocatechol dioxygenase from rhodococcus opacus 1cp in complex with pyrogallol (see paper)
33% identity, 84% coverage: 32:289/308 of query aligns to 3:253/256 of 3o6rA
3o6jA Crystal structure of 4-chlorocatechol dioxygenase from rhodococcus opacus 1cp in complex with hydroxyquinol (see paper)
33% identity, 84% coverage: 32:289/308 of query aligns to 3:253/256 of 3o6jA
3o32A Crystal structure of 4-chlorocatechol dioxygenase from rhodococcus opacus 1cp in complex with 3,5-dichlorocatechol (see paper)
33% identity, 84% coverage: 32:289/308 of query aligns to 3:253/256 of 3o32A
3th1A Crystal structure of chlorocatechol 1,2-dioxygenase from pseudomonas putida
31% identity, 81% coverage: 27:274/308 of query aligns to 2:246/246 of 3th1A
3hgiA Crystal structure of catechol 1,2-dioxygenase from the gram-positive rhodococcus opacus 1cp (see paper)
32% identity, 76% coverage: 28:262/308 of query aligns to 10:239/258 of 3hgiA
Q5PXQ6 Hydroxyquinol 1,2-dioxygenase; 1,2-HQD; EC 1.13.11.37 from Nocardioides simplex (Arthrobacter simplex) (see paper)
30% identity, 92% coverage: 9:292/308 of query aligns to 15:293/293 of Q5PXQ6
3hj8A Crystal structure determination of catechol 1,2-dioxygenase from rhodococcus opacus 1cp in complex with 4-chlorocatechol (see paper)
32% identity, 76% coverage: 28:262/308 of query aligns to 9:238/257 of 3hj8A
1tmxA Crystal structure of hydroxyquinol 1,2-dioxygenase from nocardioides simplex 3e (see paper)
30% identity, 92% coverage: 9:292/308 of query aligns to 14:292/292 of 1tmxA
3i51A Crystal structure determination of catechol 1,2-dioxygenase from rhodococcus opacus 1cp in complex with 4,5-dichlorocatechol (see paper)
32% identity, 76% coverage: 28:262/308 of query aligns to 8:237/256 of 3i51A
>BWI76_RS13700 FitnessBrowser__Koxy:BWI76_RS13700
MSNAFVQPDAVQNLLRESAGLNISGGDERFKTIIHRLLENICTLIDDYNITEEEFWHAVN
YLHELGGRQEAALLAAGLGLEHFLDLRQDAIDAAEQRETGTPRTIEGPLYVANAPLADGH
TRMDDGKDAGEVMWLYGQVNDTQGRPVANAIVDIWHANTLGNYSFFDKSQSEYNLRRRIR
TGADGRYSVRSIMPSGYGCPPDGPTQKLLNQLGRHGNRPAHIHFFVSAPGYKHLTSQINL
NGDKYLWDDFAFATRDGLIADPVKVSDRELIQQRELDGEHTEVRFDFTLCKALNADEEQR
GTRLRAQE
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory